KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1388
Entry
VP1388            CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
SSDB
Other DBs
NCBI-GeneID: 1188895
NCBI-ProteinID: NP_797767
UniProt: Q87PW2
Position
I:1483439..1485205
AA seq 588 aa
MWRIQMHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSEDILRNLPKELAQKISIS
AKKSSSGLLTAIRHELGNGNWVALSSFSRRTPLTDTQLQSFPRLKAQLESVSSTGESKVY
KAGYKQVKDDVTLVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVTVG
KADTENKHRSLATFKDLEAEGKTLYIKIPCSDQPQPILLKLAEDLQPVDKETQMDEWDNV
LVPVVPLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSR
PKRHADIYMTNPETGGVFAYEPFQIVQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGY
EPQIKEKIETNLSPINASSPVGRSAQGYPLPHIWLPYKIKGEPQEVYLAYNSKRLSESEL
SELESDPGTKAIKVTDLNHYSSEKSFKMGDGSVRLLSVLPSAATSKPEKYAMLRSQINKN
VAVVYLLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFT
GWPAEVKEVDLLRGYQGNSHHGRDNKTVIFAQTPIADLLAYKKKDQPS
NT seq 1767 nt   +upstreamnt  +downstreamnt
ttgtggagaattcaaatgcatttagtttgcaaatttatacctagctcgaagctttcctcc
aacgagctatcctacgtccttacacctgatgagtgtatagggcagctttcgcgtgtgcga
aattcagaagacattctcagaaaccttcctaaagagcttgctcagaagatctcaatctct
gccaagaagtctagctccgggttgctaacggctattcgacacgagctaggaaatgggaac
tgggttgcgttgtcttctttctctcgtagaacgccgttaacagatacccaattacaaagt
ttcccaagactaaaagcacagcttgaatcggtctcatcgactggtgagagcaaagtttat
aaagcgggttataagcaggtaaaggacgacgtgactttggttcgtagctacacgcatgtc
ccttctgagccaagtccagaccaaaaaatcgttgtcgagtttgcagggcagtggtctagc
aacgcggcatgtttgatgttgggaaaaaccgaagctcaaaaagaaaaagttactgtaggc
aaggctgatacagaaaacaaacaccgcagcctcgcgacatttaaagatctcgaagctgag
ggcaaaacgctctatatcaaaatcccttgttccgaccagcctcagccaatcttgcttaaa
ctcgccgaagacctgcaacccgttgataaagaaactcaaatggatgagtgggataacgtg
ttggtgcctgtggttccgctgcacttccctggtagcgataaatcagatgaagctgcagaa
gtgtttaagtcaggctacgtgtatgttgtttggaacaataaaatttggcgcgaagtggca
attacggaaaatggttacttttcagatacggacattaatagtgttcgtgaaggctctaga
cccaaaaggcacgccgatatctatatgaccaatcctgaaacaggcggtgttttcgcttat
gagcctttccaaatcgtgcagaacggcaaggtggtaagtgaaggctctttgaatggctct
ggagaggctcgagtgttcaacttagttgaggaagaagttgagatagtcatgaccggctat
gagccacaaatcaaagaaaagattgaaacaaatttgagccctattaatgcttctagccca
gtggggcggagcgcgcaaggttaccctctcccgcatatatggcttccttacaagattaaa
ggtgagcctcaagaagtatatttggcttataacagtaaacgattgagcgagagtgaacta
tctgaactagaaagtgatcccggaaccaaggccataaaagtcactgatcttaaccattac
agcagtgagaaaagctttaaaatgggagacggttctgttcgtctgctctcagtattacca
agtgctgcgacctcaaaacctgaaaaatacgcaatgttacgaagccagataaataaaaat
gtagcggtcgtgtatttacttaaatctgtcgagatagttttcgaatatccgggctatacg
acgctggacgagtcagatgattactttgagttaaggcaaagcgatggtgattggtcgcag
cgagtgtgcttgcgccaatgtataaaaaaagagaatggttctaggttgattcgttttact
ggttggcctgcagaggttaaagaagtggatcttctccgtggttatcagggcaatagtcat
cacggaagagataataaaacggtcatttttgctcaaacacccattgcggatttactggct
tataagaaaaaagatcagccaagttaa

DBGET integrated database retrieval system