KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1401Help
Entry
VP1401            CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpa02044]
    VP1401
Secretion system [BR:vpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VP1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N COX5A
Motif
Other DBs
NCBI-GeneID: 1188908
NCBI-ProteinID: NP_797780
UniProt: Q87PV0
Position
I:1504684..1506258
Genome map
AA seq 524 aa AA seqDB search
MSVIEIERLLAPISDVNPVGEDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHATEVL
EHHSKDLKAICYLVRALTEEFGLQGFEQGLKLLSEALNRFGVELYPSRKRGRDGAVEWLN
HQFKLVSSRFAESAQSWDLVSGCISTIEEVQRQYDDIYQDSEADFFEIRSQLNALSQQAA
VDEQSDGAMATIEQTAPLTASQPVAVETPAQSEVQTVVAKAVPSAPKPAPVKKTVTKEVD
VDTDFSSPTASKRTLKKVAEVMIHANPSEPLAYRIYRHLTWDDIDGLPDHQSNETPLSLA
VSSDQQAEYRDKASQESDIDTVKRLERTLTDAPFWLTGHYFVYSMLNNLGFNDAAFAVKQ
EVKRFVDSLEGIELLTFKNSIPFADEATLSWLSTQAATSSSAQSVVQTIVITDEDSLPME
DITLANLGEYAAELAHKLELDFSGRGQFMLHLQLIAAYQSVGLYPLCLPYLEKAWEVQQA
FNLASWEPHLSSQLEDLIRKTLHQLFRNKDLLPEQYEKWKAIYD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgattgaaattgaacgtttacttgcgcctatctctgacgtaaatcctgtcggt
gaagatgctcgttacgagttttgttatgaaatgatggaatccgaagtgaagaagttcgga
tccttgtttggcgaaacggtagattggagtgtcgtaaaaacgcacgccactgaagttctt
gaacaccacagcaaagatttaaaagcaatttgttaccttgttcgcgcgcttacagaagag
tttggtctgcaaggtttcgagcaaggtctaaagctgcttagtgaagcgttaaatcgcttt
ggcgttgagctgtacccgtcgcggaaacggggtagagatggtgcggtagagtggttgaac
catcagtttaaattggtgagcagcaggtttgcagaaagcgctcagtcatgggatttggtt
tcaggttgtatttcgactatcgaagaagtccaacgtcagtacgacgatatttaccaagac
tccgaagcggacttctttgaaattcgtagtcaactcaatgcgctatctcaacaagcggct
gtcgatgagcaaagcgatggtgcaatggctaccatcgaacaaacagctccgctaacggct
tcacagcctgtagcagtagaaactccggcacaaagtgaagttcaaaccgttgtagcaaaa
gcggttccgtcggctcctaaacctgcaccagttaagaaaacagtaacaaaagaagtcgat
gtcgatacggatttttcatcgccgaccgcttctaaacgtacacttaagaaagttgcggaa
gttatgattcatgcgaatccaagtgagccgctagcttaccgaatttatcgtcacctaact
tgggatgatattgatggtcttcctgatcatcaaagcaatgaaacgccattgagtttggct
gtgtcgtctgatcagcaggctgagtaccgcgataaagcctctcaagaaagcgacattgat
acagttaagcgtttggagcgcacgttaaccgatgctccgttttggctgacgggtcactac
tttgtttattcgatgttaaacaatctaggctttaatgacgcagcgttcgctgtgaagcaa
gaagtgaagcgttttgttgattcattagagggcattgaactcctcacatttaagaattct
ataccatttgcagatgaagcaacgttgagctggttatcgactcaagctgcaacttcttca
agtgctcaatctgtcgttcaaacgattgtcatcacagatgaagactcactgccaatggaa
gatatcaccctagccaacttaggggagtatgccgcagaactcgcacacaaactcgaactg
gatttctcgggacgtgggcagtttatgctgcatttacaattgatagcagcttaccagtct
gttggattatacccgttgtgtttgccttaccttgaaaaagcttgggaagtgcaacaagcg
tttaatctcgcgagctgggaaccccacttatcgtcacagttagaagacctgattcgaaaa
acactgcatcagttattcagaaacaaggatcttttgcctgaacagtacgaaaagtggaaa
gcaatttatgactaa

DBGET integrated database retrieval system