KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1402
Entry
VP1402            CDS       T00120                                 
Name
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpa02044]
    VP1402
Secretion system [BR:vpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VP1402
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: BAC59665
UniProt: Q87PU9
Position
1:1506285..1506791
AA seq 168 aa
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKD
NFNDVLEGMSPNVKVNVENRLSDEEGAQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELR
EALVALKGPLGNVPAFRKKIASVLQDEEARKKLLDELSIGNDQDAKEE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcacgtgacggctcggtggctcctaaagagcgaattaatatccgttatgttccagca
actggtgatacgcaagaagacgttgagctgccgctgagcatgatggtggttggtgacttt
actgcacgtgcagatgagacgccaatcgaagaacgtaccccaattaacatcgataaagac
aactttaatgacgtgttagaaggcatgtctccaaacgttaaagtaaatgttgaaaaccgc
ttatctgatgaagaaggcgcacagatcggtgttgacctaacgttccaaaatatgaaggac
ttctctccggaagcgatcgcgaaaagtgtacctgaacttaacagtcttcttgagcttcgc
gaagcattggttgcactaaaaggtcctctaggtaacgtacctgcgttccgtaagaagatt
gcatcggttcttcaagacgaagaagcaagaaagaaactgttggatgaactaagcattggc
aacgaccaagacgcgaaagaagagtaa

DBGET integrated database retrieval system