KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1415
Entry
VP1415            CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
SSDB
Motif
Pfam: DUF4150 AHH
Other DBs
NCBI-GeneID: 1188922
NCBI-ProteinID: NP_797794
UniProt: Q87PT6
Position
I:1522119..1524323
AA seq 734 aa
MRSLLLFNQQNSNGLVMGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPIVPIPYGN
NAKSADLAGGTTTISMDGGNSVAIKGSTFSKSTGDAGGDKKGVASGTIEAEAKFISASPT
VKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVTEADDGTFTIDIDYRYPDGDPVYKA
DFKIIDSTGTEHVGTLSDKGKGTITGLPAGSISLFLGEDKRDIEPIQKPQPNKDYLELPG
PLDLVEFAGRGLVEYWDAVEMPSDYSQWAWGAIMGDFNQDRSAGQIAFDSAVTAIPFIDQ
IGDGRDISANLYAFYNADDIREDKEKYTDLVITLVGFIPTAGSLIKGLFKELKILGKAAD
LDMIAAFLRAGAKGDVVKWMQSLDMSVIKNDIYGQLDDITKQVKTLMDTLEQESRKRGYT
VVADAYKRCVEQLDDFFKKADGPISKVLSDFDDRLKMILPEAPLVTSGTSFSISAGTAQG
GGKAEVIKTRNKTKKKTDTCPLCNKKIGKGKKECEGAKVGSISKAVMDDGSSQKLWKEFE
IRNGWRDKTEHPWWHGAGAVQAHHLIPKNAFKLKNAKSKQTKEKMMFLRRIAQTCAYNID
FWKNGIGLPNKKETACFLRKPRHAGGHDRNEFNYTNECVKLVHDKLSSDIKKRTKEGSCS
KTTNSSLIMKFNESSKNIFDNIADFIWFITRDGKNYDPKVEPYVGCSSNCKKIHPIININ
TKRQIENYDLEIGK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgcgatctcttttattattcaatcaacaaaattcaaatggattggttatgggcgtaaca
gttggtgcaaatggactttcgatagttcataaaggctcaggtggtgaagcgaatgcaacg
ctcccagatgtttgtttaacgaaggtcggtaagccgatcgttcctatcccttatggcaac
aatgccaaatcagcagatcttgctggtggcactacgactatctctatggatggtggcaac
agtgtcgcaattaaaggcagtacgttttcaaaaagtaccggtgatgcgggcggcgataaa
aaaggcgtcgcatccggcacgatagaagccgaagcaaaattcatttcagcctcaccaacg
gttaagtttgaaggcaagggcgtatgtcgcctgtctgatcaaatgaccatgaacaaagcc
aacactatgtgtttgggcggcgcacaaaacccatcggtttctgttacggaagcagatgat
ggaacatttaccatagacattgattatcgatacccagatggagacccagtatacaaagcc
gatttcaagattattgacagtactggtacagaacatgttggcactttaagcgacaaaggt
aaggggacgattacgggcttaccagcaggttctatcagtttattcctgggtgaggataag
agagatatagagccaatccaaaagccgcaaccaaacaaggattatcttgaactgccgggg
cctttggacttagtagagtttgctggacgtggcttggttgaatattgggatgctgttgaa
atgccgagtgattatagtcaatgggcttggggagcgatcatgggggacttcaatcaagat
cgatctgctggccaaattgcttttgatagtgctgttacagctataccattcatcgatcaa
attggggacggtcgagacattagtgccaacctttatgctttttataatgcagacgacata
agagaagataaagaaaagtacacagatctcgttatcactctagttggctttattcccacc
gcaggtagcttgataaaagggttatttaaggaacttaaaatcttgggcaaagccgctgat
ttagatatgattgctgctttccttagagccggagcaaaaggtgatgtggtcaaatggatg
caaagccttgatatgtccgtcatcaaaaatgatatatatggtcaactagatgatattact
aaacaagtaaaaacgttaatggatacacttgagcaagagagccgtaaaagagggtatact
gttgttgctgacgcctataaaaggtgtgtggaacagctagatgacttttttaagaaagct
gacggaccaatatctaaagtcttaagcgattttgatgataggctcaagatgatcctgcct
gaggcacctttagttacatcagggacttcctttagtatttctgcagggacggctcaagga
ggaggcaaagctgaggtaattaagactcgtaataagacgaaaaagaagactgatacgtgt
ccgttgtgtaataaaaagattggaaaagggaagaaagagtgcgaaggggcgaaagtcggt
agtatcagcaaagcagttatggacgatggttcctctcaaaaattatggaaagaattcgaa
atacgaaatggttggcgagacaagacagagcacccttggtggcacggggcgggagcagtg
caggctcaccatcttattcctaaaaatgcattcaaactaaaaaatgcaaagagtaagcaa
actaaagaaaaaatgatgtttcttagacgaattgctcagacgtgcgcttacaacatcgac
ttttggaaaaatggtattggccttcctaataagaaagaaacagcgtgttttttgaggaaa
cctcgacatgcaggcggtcacgatcgtaatgaatttaactacacgaacgaatgtgtaaag
cttgttcatgacaagttaagctcagatatcaagaaaagaacaaaagaaggtagttgttcc
aagacaacaaactcttcgttgattatgaagttcaatgaatcaagcaaaaatatttttgat
aatattgctgactttatctggtttattactcgtgatggaaaaaactatgatcctaaagta
gaaccttacgtgggctgtagttcaaattgcaaaaaaatacacccgattattaatataaac
actaagcgacaaattgaaaactatgacttagagattggaaaataa

DBGET integrated database retrieval system