KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1416
Entry
VP1416            CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
SSDB
Other DBs
NCBI-GeneID: 1188923
NCBI-ProteinID: NP_797795
UniProt: Q87PT5
Position
I:1524323..1524916
AA seq 197 aa
MISDINEEYYVLVCGSGKVPSPYVSCSKSHYLIFQEPMSLKMPIRIESAAEAQEKVPLIE
AMAAPSDPVLSGRITQVLNYFDLYKVQLLPAIYTHNDDSEHSYSVLVVDNDIDAYDFDNG
LYIDRLDDGEVGNPRNCRLDPEKLSKIPLEKRYIFKIRGMMDYLVHKTIAESLVALNASG
LHLVPVLEWDIGFGMKI
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatttcagatattaatgaagagtattatgtacttgtgtgtgggtctggtaaagtacct
tctccttatgtttcttgtagtaaaagccactatttgattttccaagaacctatgtcactt
aaaatgccaatccggatagagtcagcagctgaagcccaagagaaagttccattaatcgaa
gctatggctgccccgagtgatcctgtactttcaggtagaataacacaagtcctcaactac
tttgatctttataaagttcaattgctcccagctatatatacccataatgatgatagcgag
cactcttattcagtcttagttgttgataacgatattgatgcttacgattttgataacggc
ctatatattgatcgtttggatgatggtgaggttggaaacccaagaaactgtcgacttgac
cccgaaaaactttcaaaaatcccgttagaaaaacgttatatttttaaaatacggggcatg
atggattatttagtccacaaaacaattgccgaatctctagtcgcattgaatgcaagtgga
cttcacttagttccagtattggaatgggacattggttttggaatgaaaatttaa

DBGET integrated database retrieval system