KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1479
Entry
VP1479            CDS       T00120                                 
Name
(GenBank) multidrug resistance protein NorM (Na+/drug antiporter)
  KO
K03327  multidrug resistance protein, MATE family
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpa02000]
    VP1479
Transporters [BR:vpa02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   VP1479
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-ProteinID: BAC59742
UniProt: O82855
Position
1:complement(1590882..1592252)
AA seq 456 aa
MHRYKEEASSLIKLATPVLIASVAQTGMGFVDTVMAGGVSATDMAAVSVASSIWLPSILF
GIGLLMALVPVVAQLNGSARREKIPFEIQQGVVLALLISIPIIGVLLQTQFILQLMDVEA
VMAGKTVGYIHAVIFAVPAFLLFQTLRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVYG
KFGAPELGGVGCGVATTIVYWVMFALLLAYVMTSSRLKSINVFGEYHKPQWKAQVRLFKL
GFPVAAALFFEVTLFAVVALLVSPLGPIIVAAHQVAINFSSLVFMLPMSVGAAVSIRVGH
RLGEENVDGARVASRVGIMVGLALATITAIITVLSRELIAELYTNNPEVISLAMQLLLFA
AVYQCTDAVQVIAAGALRGYKDMRAIFNRTFIAYWILGLPTGYILGRTDWIVEPMGAQGF
WLGFIIGLTAAALMLGVRLRWMHRQEPDVQLNFSLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
gtgcatcgctataaagaagaagcatcgagtctaattaaattggctacccctgtattgatc
gcgtctgtcgctcaaacgggcatgggttttgtcgataccgtaatggcaggtggcgttagc
gcaactgacatggctgcggtatctgtcgcttcaagcatttggctgccatctattttgttt
ggtattggcttgcttatggctttggttcctgttgtggcgcagcttaacggatctgcgcgt
cgcgaaaagatcccatttgaaattcagcaaggtgttgtccttgcgttgttaatcagtatc
ccgatcattggtgtgttactgcaaacacagttcattctacaattgatggacgtagaagct
gtgatggcaggtaaaaccgtcggctacattcatgctgtgattttcgctgtgccagctttt
cttctcttccaaactctgcgcagcttcactgatggtatgtcattaaccaaaccagcgatg
gtgattggatttattggtttgctgctgaacatcccgcttaactggattttcgtttacggt
aaatttggcgcgcctgagttgggtggcgtaggctgtggcgtagcaaccaccatcgtatat
tgggttatgttcgcgttgctattggcgtatgtgatgacgtcatcacgactaaaaagcatc
aatgtgtttggcgaataccataaaccacaatggaaagcgcaagttcgcctgtttaaactg
ggtttccctgttgcagcggcactattctttgaagtgacactgtttgctgtagtggcgctg
ttggtatcaccacttggcccaatcatcgttgcggcgcaccaagttgcgattaacttctct
tcgttggtatttatgttgccaatgagtgtaggtgctgcggtaagtattcgcgttggtcac
cgtttgggtgaagaaaatgtcgacggtgcacgcgttgcatctcgcgtcggtattatggtt
ggtcttgctttagcaacgattacagcaatcatcacagtactgtctcgtgaactgattgct
gagctttacaccaataacccagaagtaatctcactagcgatgcagttattgctgtttgcc
gcggtttaccaatgcactgacgccgttcaagtcatcgcagccggtgcacttcgtggctac
aaagacatgcgcgcgatcttcaaccgcacattcatcgcgtattggattcttggccttcct
actggttacattcttggtcgtacagattggattgttgaaccaatgggcgcacaaggtttc
tggcttggctttatcattggcctgaccgcagctgcgttaatgcttggtgttcgccttcgt
tggatgcaccgtcaagagcccgatgtacaacttaacttttctctgcagtaa

DBGET integrated database retrieval system