KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2389
Entry
VP2389            CDS       T00120                                 

Name
(GenBank) putative membrane transport protein
  KO
K16074  zinc transporter
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpa02000]
    VP2389
Transporters [BR:vpa02000]
 Other transporters
  Pores ion channels [TC:1]
   VP2389
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-ProteinID: BAC60652
UniProt: Q87M69
Structure
PDB: 
3CK6

Position
1:2505824..2506771
AA seq 315 aa
MGFMIEHWDFSTPMATQETTTAEHIQPNHWYHCERLHPDIRSWLEDNHVPRATVDHLLAD
ESRPSFHPLDDDNFMLILRGINMNENASPEDMLSIRILYFQGALISTRKIPSRAIMEIRQ
ALAEHKGPKSLASLLNQIIEGLNGKIDLYLDTIEETLNEFDVNDESTYNHIAAQKALISI
KRFIRPQQYAIRDLIESESELVTSRPHQYRFAHNNITRINETIEFYLGEVALFQDEIKHN
RDEKTNKNSYLFTLVATIFLPTSFLTGLLGINIGGMPGVESSMAFTWFCIALIVIFGLEW
LLFKRLGFTNKTDDE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgggttttatgattgaacattgggatttctcaaccccaatggcgactcaagaaacaaca
acggcggaacacattcaaccgaatcattggtaccactgtgaaaggcttcatcccgatatt
cgtagctggctagaagacaatcacgtaccacgtgcgacggtcgatcatctgttagccgac
gagagccgaccatctttccatcctttggatgacgataacttcatgctgatcttacgaggc
atcaacatgaacgagaatgcgtcgccggaagacatgctgagtatccgcattctctatttt
cagggcgcactgatctcgactcgtaagatcccatcacgtgcaatcatggaaattcgccaa
gcattagcagagcacaaagggccgaaaagcctggcgagcttactgaatcagatcatcgaa
gggctgaacggcaaaatcgacttgtatctcgacaccatcgaagaaacgttaaacgagttt
gacgtcaatgatgagtcaacgtacaaccacattgcggcacaaaaggcgcttatttccatc
aaacgttttattcgccctcagcaatatgcgattcgtgatttgatcgagtcagagtcagaa
ttggtaacatcaagacctcaccaatatcgctttgcgcataacaacattacgcgcatcaac
gaaacgattgaattttaccttggcgaagtagcgcttttccaagacgaaatcaaacacaac
cgagacgagaagaccaataaaaacagttacctatttactttagttgccaccattttctta
ccaaccagcttcctaacaggactacttggtatcaacattggtggcatgccgggcgtagaa
tcctccatggcgttcacttggttctgcatcgctttgattgtgatctttggcctagagtgg
ttgctgttcaaacgcttagggttcacgaacaaaacggatgatgaataa

DBGET integrated database retrieval system