KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2621Help
Entry
VP2621            CDS       T00120                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VP2621
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     VP2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like LytR_C
Motif
Other DBs
NCBI-GeneID: 1190145
NCBI-ProteinID: NP_799000
UniProt: Q87LJ1
Position
I:2762552..2763154
Genome map
AA seq 200 aa AA seqDB search
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQE
TGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQENLEKLLAAMEGVPEAERTARFHC
VLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQL
SHRGKALKSLFAQLSAQTAQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgtgctagcaacaggcaaccaaggcaaagttcgcgagatggcagatcta
ctgtctgacttcggttttgaagtattagcgcaaagtgaattcaacgtatcagaagttgct
gaaacgggcaccacgttcattgagaacgcaatcattaaagctcgccatgcagcgcaagaa
actggcttaccagcgattgcagatgattctggtctggaagtcgatttcctaaaaggtgca
ccaggcatctactcagctcgttacgccggcgaaaaagcctctgaccaagaaaacttagag
aaattgctagccgcaatggaaggcgtgccagaagcagagcgtaccgcgcgtttccactgc
gtattggtattgatgcgtcacgaaaacgatccaacgcctatcgtttgtcatggcaaatgg
gaaggtcgcattctgactgaagcacatggagaaaatggctttggttacgaccctatcttc
ttcgtaccagaagataattgtgcgtcagcagagctagagccggcacgtaaaaagcagttg
tctcaccgcggcaaagcactgaagtcactgttcgctcagttatcagcgcaaaccgcacag
taa

DBGET integrated database retrieval system