KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0180Help
Entry
VPA0180           CDS       T00120                                 

Definition
(RefSeq) phospho-beta-glucosidase B
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00010  Glycolysis / Gluconeogenesis
vpa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VPA0180
   00500 Starch and sucrose metabolism
    VPA0180
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VPA0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-GeneID: 1190867
NCBI-ProteinID: NP_799690
UniProt: Q87JR8
Position
II:complement(176615..178006)
Genome map
AA seq 463 aa AA seqDB search
MIEFPDNFLWGGAIAANQVEGAYNLGGKGLSTSDMLPNGILSPHQTREERTPGIKDLAID
FYNRYPEDITLFKEMGFTCLRLSIAWSRIFPNGDELEPNEEGLAFYDKIFDELAKHDMQP
FVTLSHYEMPYALVENYGGWGDRRVIEFFERYAKTVLERYKDKVKLWLTFNEINMSLHAP
FTGVGLPEDATEQQIYQAIHHQLVANAKAVKLCQEIVPNGKIGNMLLGAMNYPYTCNPDD
VLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGIEIQMQDGDLEDIASASVDFISFSY
YASGCASADPKQKEVGNIVESVPNPYLEKSQWGWLIDPKGLRILLNFLHDRYQKPLFIVE
NGLGARDEFDENGEIQDDYRIAYLNDHLVQAHEAILDGVELMGFTSWGPIDLVANSTAEM
SKRYGYIYVDRHDDGQGTLERKRKKSFYWYQDVIRTAGGSLKR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtttccagataatttcctttggggtggtgccattgctgcaaaccaagtagag
ggtgcatacaaccttgggggtaaaggtttatcaacatcagatatgttgccaaacggcatt
ctgagcccgcatcaaacgcgtgaagaacgaacaccaggtatcaaagatcttgcgatcgat
ttctacaatcgctatccagaagatattactttgtttaaagagatgggattcacctgcctg
cgcttgtccatcgcttggagtcgtatttttcctaatggcgatgaactggagccaaacgaa
gaaggactggcgttttacgacaaaatttttgatgagctagccaaacacgacatgcaacca
tttgtgacgctttctcattacgagatgccttacgccttggttgaaaattatggtggttgg
ggcgatcgtcgagtgatcgagtttttcgagcgttacgctaaaaccgtgttagaacgctac
aaagataaggtcaaactgtggcttaccttcaacgaaatcaacatgtctctgcatgcacca
tttactggggttggtttgccagaagacgcaacagagcaacagatttaccaagcgattcac
catcaattggtggcgaatgctaaagcagtgaagctgtgccaggaaattgtaccgaatggc
aaaatcggcaacatgttactgggtgcaatgaactacccatacacttgtaaccctgatgat
gtgttagccgccatgcatgaaaacaacaagtggttgttcttcggtgacgtgcaaactcgt
ggtcagtaccctggctatatgaagcgctatttccgtgaaaatggcatcgaaattcagatg
caagacggtgatttagaagacattgcctcggccagtgtcgactttatctccttcagctac
tacgccagtggctgtgcgagcgcggatccgaaacaaaaggaagtcggcaatattgttgag
agcgtgccaaatccatatttggaaaagagccaatggggctggttgatcgatcccaaaggt
ctgcgtattttgctgaacttcttgcacgatcgctaccaaaagccgctctttatcgtggaa
aatggtttgggagcgagagatgaatttgacgaaaatggcgaaattcaagatgactaccgc
attgcctacctcaacgatcacctagtgcaagcgcacgaagccattcttgatggcgtggaa
ttaatgggtttcaccagttgggggccgattgatttagtagccaactcaacggcagaaatg
agcaagcgttacggatatatctacgttgatcgtcacgatgatggacaaggcactttagaa
cgtaaacgcaaaaagagcttctactggtatcaggatgtgattcgtaccgcaggtggttcg
ttaaaacgctaa

DBGET integrated database retrieval system