KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0190Help
Entry
VPA0190           CDS       T00120                                 

Definition
(RefSeq) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00310  Lysine degradation
vpa01100  Metabolic pathways
vpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    VPA0190
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     VPA0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_3 Trp_halogenase TrkA_N NAD_binding_9 FAD_binding_2 Fe_bilin_red
Motif
Other DBs
NCBI-GeneID: 1190877
NCBI-ProteinID: NP_799700
UniProt: Q87JQ8
Position
II:188702..189928
Genome map
AA seq 408 aa AA seqDB search
MKSVYDYIVVGGGIVGVSTAWQLQQRHPECSILLVEKESGFAKHQTGHNSGVIHAGVYYA
PGSLKADFCKRGVEKTLSFCSQHNIPVENCGKLLVATNEQEVERMNALYERCHVNGIDVG
LLDEAQLKLAEPNITGLGAIYVKTTSIVDYRLVTEHMAQEFQSLGGHISLRTKVVAADEK
DEEVQLTCVSDGQSMQLNCKFLVTCSGLMADRMTKMMGIPTDFQIVPYRGEYYRLDSKHN
QVVNHLIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVQGWKREGYGKVNFNLQDTLQMLS
FSGFWKVTQKHLKTGLEEFKNSWWKPGYLKLVNKYCPSIRVEDLQPYPAGIRAQAVLSDG
TLVHDFLFAESARSLHVCNAPSPAATSAMPIGEYICDKVDEKVVAKVV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagtctatgactacattgttgtgggtggtggtatcgttggtgtgtccacggct
tggcagctccaacaacgccatccagagtgttctattttattggttgagaaagagtctggt
tttgctaagcatcaaaccgggcataacagcggcgttatccacgcgggtgtgtattatgcg
ccgggcagtttaaaagccgacttttgcaaacgaggcgtagaaaaaacgctctcgttttgc
tctcagcataatattccggtcgaaaactgcggaaagttgttggttgcaactaacgagcaa
gaagtcgaacgaatgaacgccctttatgaacgctgccacgtcaacgggattgatgtggga
ttgcttgatgaagcgcagctcaaattggcggagccgaatatcacagggttgggcgcgatt
tacgtgaaaaccaccagtattgttgattaccgcttggtaacagagcatatggcacaggag
ttccaaagtttaggtggtcatattagcttgagaaccaaggtggttgccgccgatgagaaa
gatgaagaagtacaactgacttgcgtttccgatgggcaatctatgcagttgaactgcaag
tttctagtcacttgcagtggattgatggccgatcggatgacaaaaatgatgggcattccg
accgattttcaaatcgtgccttatcgcggtgaatactaccgattagacagtaagcataac
caagtggtgaatcacttaatctacccaattccagatccagatttgccatttttgggggtg
cacttgactcgtatgattgatggttctgtgacggttggtccaaatgccgttcagggttgg
aagcgagaagggtatggaaaagtgaactttaacctgcaagatacactgcaaatgttgagt
ttttctggcttttggaaagtcacacaaaagcacttaaaaacgggcttggaagagtttaaa
aactcgtggtggaagcctgggtatttaaaactggtcaataaatattgtccgagtattcgt
gttgaggatctccagccttaccctgcagggattcgcgcgcaagcggtgttgtcggacggc
actctagtgcacgatttcctatttgcagagagtgcaagaagccttcacgtgtgtaatgcg
ccttctccagcggccacatctgccatgcctatcggagagtacatttgcgataaggtcgat
gagaaagtggtagctaaagtcgtctag

DBGET integrated database retrieval system