KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0620Help
Entry
VPA0620           CDS       T00120                                 

Definition
(RefSeq) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00071  Fatty acid degradation
vpa00072  Synthesis and degradation of ketone bodies
vpa00280  Valine, leucine and isoleucine degradation
vpa00310  Lysine degradation
vpa00362  Benzoate degradation
vpa00380  Tryptophan metabolism
vpa00620  Pyruvate metabolism
vpa00630  Glyoxylate and dicarboxylate metabolism
vpa00640  Propanoate metabolism
vpa00650  Butanoate metabolism
vpa00900  Terpenoid backbone biosynthesis
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
vpa01200  Carbon metabolism
vpa01212  Fatty acid metabolism
vpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPA0620
   00630 Glyoxylate and dicarboxylate metabolism
    VPA0620
   00640 Propanoate metabolism
    VPA0620
   00650 Butanoate metabolism
    VPA0620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VPA0620
   00072 Synthesis and degradation of ketone bodies
    VPA0620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPA0620
   00310 Lysine degradation
    VPA0620
   00380 Tryptophan metabolism
    VPA0620
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VPA0620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VPA0620
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VPA0620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpa04147]
    VPA0620
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VPA0620
Exosome [BR:vpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPA0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Lumazine_bd_2
Motif
Other DBs
NCBI-GeneID: 1191309
NCBI-ProteinID: NP_800130
UniProt: Q87II6
Position
II:624632..625858
Genome map
AA seq 408 aa AA seqDB search
MGNDIWIVSAKRTPIGCFQGLLQPYSAPQLGAFAIQAAMKSLGENVLSETVIDEVLMGCV
LPAGCGQAPARQAALGAGLPPSTGCTTINKVCGSGMKSIMLAHDLIKAGTIRTAVAGGME
SMTNAPYLLKEARNGMRLGHHSTYDHMFLDGLQDAYEGHLMGVYAQQIANRLKFSREKMD
EWATMSAKRALEAQERGLFDDEIAPIDIRTKTATTHLDYDEHPRSIDLEKIPQLKPAFDK
NGSVTAANSSAISDGAAALILMDEETARHQNLTPLAIIKSHATHARKPDEFTLAPVYAIE
QLLSQLDWSIDEIDLWEINEAFAVVTQIAVAELGLDSSKVNIKGGACALGHPIGASGARI
LVTLIHSLRQLQALGIDGDASNKKVMRGVASLCIGGGEATAIGIEIPL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgacatttggattgtcagtgcgaaaagaacgccaattgggtgctttcaaggg
ctgttgcaaccgtactccgcaccgcagttaggcgcatttgccatacaggccgcgatgaaa
tcgctgggtgaaaacgtactttctgagaccgtaattgatgaagtgttgatgggctgcgta
ctaccagccggatgcggacaagcgccggctagacaggcagcgctcggtgcgggtttacca
cccagtacagggtgcacaaccatcaataaagtttgcggttcgggaatgaaaagcatcatg
cttgctcatgacttgatcaaagctggcactattcgaacggctgttgctggaggtatggaa
agcatgacgaatgcgccctatttattgaaagaggcgcgcaatggcatgcgattagggcat
cactccacttacgatcacatgtttctcgatggattgcaggatgcctacgaagggcacttg
atgggcgtctatgctcagcaaattgcaaataggctcaaatttagccgtgagaaaatggat
gagtgggcaaccatgtctgcaaaacgagcgttagaagcgcaagagcgcggtttgtttgat
gatgaaattgcacccattgacatccggacaaaaacagccacaacccacctcgattatgat
gagcatcctcgctccatcgacctagaaaaaattcctcagctcaaacccgctttcgataaa
aatggctcagtgactgcggcgaactccagtgccatttccgatggcgcagccgcgttgatt
ttgatggatgaagaaacggcgcgccaccaaaatcttaccccgcttgccataatcaaatcg
cacgcgactcatgcgagaaaaccggatgagtttacgttggctccggtctacgccattgaa
caattgttgtcgcaactggattggtcgattgacgaaattgatctctgggaaatcaacgaa
gcctttgcggtagtgacacaaattgcggttgcggaattagggcttgattcaagcaaggtc
aatattaaaggcggagcttgtgcgctcgggcatccaattggtgccagtggggctcgcatt
ttggtcacattgatccacagtttacgacagctacaagcactggggattgatggggatgca
agcaacaagaaagtgatgcgaggcgttgcgtcactgtgtattggcggtggcgaggcgaca
gcgataggtatcgagatcccgctgtaa

DBGET integrated database retrieval system