KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0870Help
Entry
VPA0870           CDS       T00120                                 

Definition
(RefSeq) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00061  Fatty acid biosynthesis
vpa00650  Butanoate metabolism
vpa01100  Metabolic pathways
vpa01120  Microbial metabolism in diverse environments
vpa01200  Carbon metabolism
vpa01212  Fatty acid metabolism
Module
vpa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VPA0870
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VPA0870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vpa01004]
    VPA0870
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     VPA0870
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     VPA0870
Lipid biosynthesis proteins [BR:vpa01004]
 Fatty acid synthase
  Component type
   VPA0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-GeneID: 1191559
NCBI-ProteinID: NP_800380
UniProt: Q87HT6
Position
II:complement(911670..912869)
Genome map
AA seq 399 aa AA seqDB search
MRIEPLIQGVVARSAHPYGCHASIKEQIEYVKKAPKIKSGPKRVLIIGASSGFGLAARIA
LTFGGAEADTIGVSFERGPSEKGVGSAGWYNNIFFKQEATHAGRTAINIVGDAFSDSVRN
EVIEAIETYFEGEVDLVIYSLAAGVRPKPHSDTFWRSVIKPIGESVTGASILLENDQWVE
TTLEPATEEEAEATIKVMGGEDWESWIDTLINTESVAQGCKTIAFSYMGPEVTHPIYLDG
TLGRAKIDLHQTSHALNLKLANFDGGAYATVCKALVTKASVFIPALSPYLLALYRVMKEK
GTHERCIEQMQRLFTTKLYDQPKVPVDGERLIRIDDLELDPQTQAEVSHLLEQMNTENFK
ECGDYQGFKDEFMKLNGFNFDDVDYSQDISLETLASLKP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatagaaccgttaattcaaggtgttgttgctcgctctgcgcatccatacggttgc
catgcatccataaaagagcaaattgaatacgtaaaaaaagccccgaagatcaaaagcggc
cctaaacgagttttaattattggtgcttcctccggttttgggttagcagcacgtattgcc
ctaacgtttggcggcgctgaagcagacaccattggcgtctcgtttgaacgaggcccatct
gagaaaggggttggcagcgcaggctggtacaacaacatctttttcaaacaagaagcaaca
catgcaggacgcactgcaatcaatattgttggtgatgcattctctgactctgtccgtaat
gaagttatcgaagcgatcgaaacctactttgaaggtgaagtcgatttggtgatttacagc
cttgcagcgggcgttcgtccaaaacctcattcagatacgttctggcgcagtgtgattaaa
cctattggtgaatcggttactggcgcttccatcttacttgaaaatgatcaatgggttgaa
accacgctcgagcctgctaccgaagaggaagcagaagcgaccattaaggtaatgggtggt
gaagattgggaaagctggattgatactctcatcaacactgaatccgtcgctcaaggttgc
aaaaccattgcattctcatacatgggcccagaagttactcacccaatctatctcgatggt
actttaggccgagccaaaattgatttgcaccaaaccagccatgcattgaatctgaaactg
gctaacttcgacggtggtgcttacgccacggtgtgtaaagcgctggtaaccaaagctagt
gttttcatccctgctctgagcccttaccttttagctctgtaccgagtaatgaaagagaaa
ggcacgcatgaacgctgcatcgaacaaatgcaacgtctgttcacgacgaagctttacgat
cagcctaaagttcctgttgatggcgagcgattaattcgaattgatgacttagaactggat
ccgcaaacgcaggctgaagtgagtcatttattagaacaaatgaatacggagaactttaaa
gagtgtggtgattaccaaggctttaaagacgagttcatgaaactaaacggctttaacttt
gacgatgtagactactcgcaagacatttcgttagaaaccttggcgtcacttaagccataa

DBGET integrated database retrieval system