KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1030
Entry
VPA1030           CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpa02044]
    VPA1030
Secretion system [BR:vpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VPA1030
SSDB
Motif
Pfam: T6SS_TssF DUF2397
Other DBs
NCBI-GeneID: 1191725
NCBI-ProteinID: NP_800540
UniProt: Q87HD5
Position
II:complement(1085769..1087592)
AA seq 607 aa
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVEDPHVERLLEGCAFLTARI
RQSLDNSYPQFTESLMGQLYPDFHAPIPSMSVIKLNCSESTTSSFAIPVGERVEVSAPGY
QDCQFRTGYPTTMYPLDIISGSFENAPFKPTGSKWEHNAHSVLRCQLSAHDSESSINSMG
IDCLRLYLNGQTQLTLKLYQMLFQSLIGLSIVLDGKEIMPLTKRHLQSVGFGDEEQVVPY
SKRSFSGSRLLVEYLHFPEKFMFFDLIELGLDKLEIQGQVEICFYFDTSDDWLPKQVDEE
SVMVGCVPIVNLFKSTMEPKRLLPTEYEYQLSPQYQDAESNEVVSISDVTLRNWNKTYEH
LPCYHSGEHTHYMSASEVYWLMRREDKNWAGGYDEPGRETYVSFVDKQYQLFSPESRDNW
LMYVEAECCNRNLPQKIPFGGGLPKVQLPNVDDNFKSIRCLTSLSETLRPEMDESTRWQL
TKLLTLNHFTEADGLATLKQTLNLYAFAGTAETKAVIDALVKLEFEHTTGRVSQKGKVGF
AHGVKLVLTVSDQILPKEQIFLLGSVLSVYFAQYAEINVFTQLEIKLKSTSSSFHVWPAL
TGDKVLL
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgagtgaagagtttctaaaatactacaatcgtgaattggcctatctgcgacacaaaggg
caagagtttggcgagcaatatcctaaaattgcggctaggttacgtatcagcgaagaacaa
gttgaagacccacatgttgaacgtctgttggaaggttgtgcttttttaaccgctcggata
agacaaagtctggataacagttacccacagtttacggaatcactgatgggacagctatat
ccggactttcatgcgccaattccttcgatgtccgtgatcaaattgaactgttcagagtca
accactagttcatttgctattcctgtgggtgaaagagtcgaagttagtgcccctggatat
caagattgccagtttcgaaccggttacccgacaacaatgtatccactcgatattatctct
ggttcatttgagaacgcgcctttcaagcctactggctctaagtgggagcataatgcgcac
tctgtactaaggtgtcagctgagtgctcatgattcagagtcctctatcaattccatgggt
atcgattgtttgcgtttgtacttaaatggacagacgcaattaacactcaagctatatcaa
atgttattccaaagtttgattggtctttcaatcgtattggatggtaaagaaatcatgcct
ctaactaagaggcatcttcaatcggttggttttggggacgaggaacaagtcgtcccttac
agtaagagaagtttttcgggatctcgtttattggtcgagtaccttcattttccagaaaaa
ttcatgttctttgacttgatcgagctcggcttagataagttagagattcaagggcaggtc
gagatttgcttttacttcgatacaagcgatgactggctaccaaagcaagtagacgaggaa
agtgtcatggttggctgtgttcccattgtaaatctgttcaaatcaaccatggaacctaaa
cgtctccttccaacagagtacgagtatcaattatctcctcagtaccaagatgcagagagt
aatgaagttgtctcgatttctgatgttaccttgagaaactggaacaaaacttacgagcac
ttaccctgctaccattcaggagagcacacgcactacatgagcgcgagtgaagtgtattgg
ttaatgagacgagaggataaaaactgggccggtggctacgatgagcctggtcgagagact
tatgtttcttttgttgataagcaataccagttgttcagccctgaaagcagagataattgg
ctgatgtatgtggaagctgagtgttgcaatcgtaatttgccacaaaaaattccatttggt
ggcgggctaccaaaggttcagttacccaatgttgatgataattttaaatcaattaggtgc
ttaacgtctctctccgaaacgcttagaccagagatggatgaaagcacacgatggcagctt
accaagctattaacattgaaccattttactgaagctgacggcttagcaacgttaaaacaa
acattgaacttgtatgcatttgcaggcactgccgaaacaaaagccgttatagatgctcta
gtcaagctagagtttgaacatacaaccggtagggttagtcagaaaggaaaagttggtttt
gcacatggagtaaagctggttctaacagtatccgatcagatactgccaaaagagcagatc
tttttattgggtagcgtgttatctgtttactttgctcaatatgcggagattaacgtgttt
acgcagttagagattaagttgaaatcaaccagcagctcctttcacgtatggcctgcgctg
acaggtgataaggtgttgttatga

DBGET integrated database retrieval system