KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1040
Entry
VPA1040           CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VPA1040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpa02044]
    VPA1040
Secretion system [BR:vpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VPA1040
SSDB
Motif
Pfam: DotU OmpA GPW_gp25
Other DBs
NCBI-GeneID: 1191735
NCBI-ProteinID: NP_800550
UniProt: Q87HC5
Position
II:complement(1098604..1099905)
AA seq 433 aa
MVSMEQTIVKPTPGGRAAVSKAQPQRSADSTVVISKNPELVNNDSVVAYGDNPLLAEANG
LLSIIGQIRATATHSDPLFLKETLAQKLRDYENRLRQHDVDLETIDTARYCLCCSLDEAV
LNTNWGSQSFWTHDSLLSSFYASSQGGEAFFKHLDSCLAHPESHLDLLELMYVCLSLGFI
GQYRLEKNGLEAHRRLRKQVVSVLKSHGRGVQQELSNKVEQHILAGAQVSERAPLWVVCS
VTSALLVCIFMYFSYELNKASNQTFAQLVNLIQPTPAVSNPMVESKSAPIAERISMYLAT
EIGKDLVTVEALQDRVRISLKAQDLFESGSASVVAYIQPVISKVARTLEATQGKIIITGH
TDDRPIFTSKYPSNWHLSLARATSLSEQLISNSALKGRVIPEGLGDARPLVENDSEKNRA
MNRRIEIDLIVGN
NT seq 1302 nt   +upstreamnt  +downstreamnt
gtggtaagtatggaacagacgatagtaaaacctactcctggcggaagagcggctgtatct
aaagctcagcctcaaagatcagcagacagtactgttgtgatatccaaaaaccctgagttg
gttaataacgattcagttgttgcttatggagataatccactattggcagaagctaatggt
ctactttcgattattggacaaatcagagcaacagctactcattccgatcctttgtttctt
aaagaaacgctcgcgcaaaaacttagggattatgagaatcgtctgcgtcaacatgatgtt
gacttggaaaccattgataccgcacgttattgtctgtgttgttctttagacgaagcagta
ttgaataccaattggggaagtcaatcgttttggacacatgattctctgttgagttctttt
tacgcgagcagccaaggtggagaggctttttttaagcatctagatagctgtttggctcat
ccggaatcccacctagatttactagagctaatgtacgtatgcttatctttgggttttata
ggtcagtatcgtttagaaaaaaatgggcttgaagctcaccgtagattgagaaaacaagtt
gtatcagtgcttaagtcacatggtcgcggagtacagcaagagcttagtaacaaagtagaa
caacatatattggcaggtgctcaggtttcggaacgtgctcctctatgggtggtttgttcg
gtaacttccgcactgcttgtttgtatttttatgtacttcagctacgagttgaacaaagct
tccaaccaaacttttgctcaattggtaaacctgattcaaccaaccccagcagttagtaat
cctatggttgagtcaaagtcagcacctattgccgaaagaatatctatgtatttggcaacg
gagattggcaaggatcttgtcactgtggaagcgttgcaagatagagttcgtatttctctt
aaagctcaagacctatttgaatctggtagtgcgagcgttgtggcttacatacagccagtt
atttctaaagttgcacgcaccttagaagcgacacaagggaagatcataattaccgggcat
accgatgaccgtccgatatttaccagcaagtacccatccaattggcacttgtctttagct
cgggcaacttctctttccgaacagttaatctccaacagtgcacttaaaggaagagtgatt
cctgaagggttgggtgatgcgagacctttggtagaaaatgatagtgaaaagaaccgagca
atgaatcgtcgaattgaaatcgatcttattgtgggcaactaa

DBGET integrated database retrieval system