KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1263
Entry
VPA1263           CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
SSDB
Motif
Pfam: Pyocin_S LysM
Other DBs
NCBI-GeneID: 1191959
NCBI-ProteinID: NP_800773
UniProt: Q87GQ2
Position
II:1341842..1344451
AA seq 869 aa
MSYKVLPLSEVMSHEFGLIEGNFHNISEADIASAIPSHLTFEQLKQHLYEGNLALVSDTP
QTPALLSYNDPIGPKTWRLNSEVISELSDDAANNLLAITKTTRATGGYRSCIGETSTLER
VYTPQPIATESEEEITKEFEYSFEVGCSDATIKKMVHSDFALAKTEKENAVTRWEQTNTE
QGTRYTALCVFDEPKRLNIHIADDNLGLTPLEAVTLQKAGSCKTDEGFIPVVPAVRLGER
LGLPTEGYYYHFNDGELVQEYKILGEEKWAFYATQSTQDKLNDERGFTKDQSAILVYWKL
ADQIIENQYIIYLERQITREELDNLSEDWLCENGIKLDIPALFDAVKQPEEARSEGNNDE
TQAEQTAATHTVTVGEDWQSIAELYGMGAKALLLLNPVFEADPLSLAVGDEIIVAEKQQQ
QAPDKKNTFPPLRPQTYNNIRNSHYQHSDPLLGLTKYRAINTADCIEGDVVILNLKDATS
SIVFAKSCTRPEGCIEIGDQQESISNFGPWSFFFAQANANPAAVIPAIQATQAQMAMGSS
AAVAGSPEQMQQTQTAAMQLDKLAGTLKEKIVEGYRWQVEGIGALFAMQQSLFGDNTQYT
DQDLRQVTTAQSRVRVHITEPQGGEFYPHVQGYHVDDTRIPIKYVKQGNNGQLSVAIEEN
GPTIYWTPEENGEASWQTTPDHSDGFEKDDILVTPIHSDSDANVTVTPAPEEKDWRDAIL
VFPESSGIAPLYVVYKESPRDKPGVVTGKGEDIFGIWLADAGKDLGAPIPSQIADKLRGR
EFSSFDAFREGFWYAVGEDQTLINQFSRANQRLIKRGRSPFSLPSEQVGGRQRYELHHKE
EIQYGGEVFHVDNLCVLTPKRHISIHKDQ
NT seq 2610 nt   +upstreamnt  +downstreamnt
gtgtcctataaagttcttccactgtcggaagtaatgtctcatgaatttggattgatagag
ggcaacttccataatatttcggaagcggatatcgcctctgctattccttcacatcttact
tttgaacaactaaagcagcatctctacgaaggtaatctcgcactcgttagtgatacgcct
caaactcctgctctgcttagttacaacgacccaataggtcctaaaacttggcggctgaat
tctgaggttatctctgaactttcggatgatgcggctaataatttgttagcaataacgaaa
accaccagagcaacgggaggttaccgctcttgtatcggggaaacctcgacgctcgaacga
gtttacacgccgcagccaatcgcaaccgaaagtgaagaggaaatcaccaaggaatttgag
tacagctttgaagttggctgctcggatgccaccataaagaaaatggtgcacagtgacttt
gctttagcgaaaactgaaaaagagaacgcggtaacccgctgggaacaaaccaataccgag
caaggcacccgctacactgcgttatgtgtatttgatgagccaaagcgtttaaatatccac
atagctgatgacaatctcgggctgacgccactggaagccgtcacattacaaaaagccggc
agctgtaaaacggacgaaggttttatacctgttgtccctgcagtgcgattgggcgaacgt
ttaggtttgcctacagaaggttattactaccactttaatgatggcgaacttgtccaagaa
tacaaaattctaggagaagaaaagtgggcgttttacgcaacgcaatcgacacaagacaag
ctcaatgatgagcgtggttttaccaaagaccaaagcgcaattttggtgtattggaaatta
gctgatcaaatcatcgagaatcaatacatcatttatcttgagcgccaaatcacccgagaa
gagcttgataatctaagtgaagattggctgtgtgaaaacgggataaagttggatatcccc
gcattgtttgatgcggtcaaacagccggaagaagcgcgctcagaaggtaacaacgatgag
acgcaagcggaacaaaccgcagcgacgcacaccgtaacggtaggggaagactggcaaagc
atcgctgaactatatggtatgggagctaaagccttgctcttgcttaacccagtgtttgag
gccgaccctctgtcacttgcggtaggtgatgaaattattgttgctgagaaacagcaacaa
caagcaccggacaaaaagaatacctttccgccgctgcgcccacaaacttacaacaacatc
cgcaacagtcattatcagcacagtgatccattgctcgggttgaccaaatatagagccatt
aacactgccgattgcatagaaggcgatgtggtaatcctcaatttaaaagacgccacaagc
tcgatcgtgttcgctaaatcctgcaccagaccagagggatgtattgaaattggcgaccaa
caagagtcaataagtaactttggtccttggtcattcttctttgcacaagccaatgcaaac
ccagctgctgtcatacccgccattcaagcgacacaagcacaaatggctatgggcagttcc
gcagctgtcgccggttccccagagcaaatgcagcaaacccaaaccgcagcgatgcagtta
gataaactggccggcacattgaaagaaaaaatcgtcgagggctaccgctggcaggtcgaa
ggtattggcgctttgtttgccatgcagcaaagcttatttggcgataacacccaatacaca
gaccaagatttacgccaagtaaccacggcgcaaagccgcgttcgtgtccacattaccgag
ccccaaggtggtgagttttatccgcacgtacagggctatcatgtagatgacacacgaatc
cccatcaaatatgtgaaacaagggaacaatggtcagttgtccgttgcgattgaagagaac
ggaccaaccatctattggacaccagaagaaaacggtgaagcaagttggcaaactaccccc
gatcatagtgatgggtttgaaaaagacgatatacttgtcacgccaattcactcggatagt
gatgcaaacgtcaccgttacgcctgcgccagaagagaaagactggcgcgatgcgatcttg
gtattccctgaaagctcaggtattgctccgctctatgtggtttacaaagaaagcccgaga
gataagcccggagtagttactggtaagggcgaagatatctttggtatctggttagctgat
gcgggtaaagacttgggtgctccaataccttcccaaattgctgataagctaagaggaaga
gagttcagtagctttgatgcatttagagaaggcttttggtacgccgttggtgaagaccaa
actttaatcaaccagttcagccgtgcgaatcaacgtttgatcaagagaggccgttctcct
ttttcgctaccaagtgaacaagttggagggagacaaaggtatgagttacaccacaaagaa
gagatacagtatggtggagaagtattccatgtagataatttatgtgtccttaccccgaaa
cgacatatcagcatacataaggatcaataa

DBGET integrated database retrieval system