KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0029Help
Entry
VPBB_0029         CDS       T02409                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00071  Fatty acid degradation
vpb00280  Valine, leucine and isoleucine degradation
vpb00281  Geraniol degradation
vpb00310  Lysine degradation
vpb00362  Benzoate degradation
vpb00380  Tryptophan metabolism
vpb00410  beta-Alanine metabolism
vpb00640  Propanoate metabolism
vpb00650  Butanoate metabolism
vpb00903  Limonene and pinene degradation
vpb00930  Caprolactam degradation
vpb01040  Biosynthesis of unsaturated fatty acids
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb01130  Biosynthesis of antibiotics
vpb01200  Carbon metabolism
vpb01212  Fatty acid metabolism
Module
vpb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VPBB_0029
   00650 Butanoate metabolism
    VPBB_0029
  Lipid metabolism
   00071 Fatty acid degradation
    VPBB_0029
   01040 Biosynthesis of unsaturated fatty acids
    VPBB_0029
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPBB_0029
   00310 Lysine degradation
    VPBB_0029
   00380 Tryptophan metabolism
    VPBB_0029
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VPBB_0029
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VPBB_0029
   00281 Geraniol degradation
    VPBB_0029
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VPBB_0029
   00930 Caprolactam degradation
    VPBB_0029
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VPBB_0029
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VPBB_0029
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VPBB_0029
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VPBB_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGB08556
Position
1:complement(28066..30237)
Genome map
AA seq 723 aa AA seqDB search
MIYQADTLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALTSHQGLKGLMLTSD
KDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
IGLLDAVVETDALYESALQTLTSAINEKIDWQARRKQKTSPLTLSKLESMMSFTMAKGLV
AQKAGPHYPAPMTAVITIEEGARFARNEALDIERKYFVKLAKSEEAKALVGLFLNDQHIK
GIAKKAAKSASKNTERAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEASKL
LNKRLAQGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKAAVLSEVESHAG
EDTVITSNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKVDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEANKYGQKNGNGFYSYTIDKKGK
PKKTFTEDILPVLADVCADKQEFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEFVEMAKQHADLGAMYHVPQMLIDMAAKGESFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgacaccctacaggtaaaggaaatacaagatggcatagcagagctg
agcttctgctcccctaaatccgtaaacaagctcgacctagcaacgctagagtctctcgat
aaggctcttgatgcgttgacttcacatcaaggtctaaagggcttaatgctcacttcagat
aaagatgcgttcatcgttggcgcagacatcactgaattcttgggcctcttcgctaaaaca
gacgccgagctcgatcaatggctacaatttgccaatagcattttcaataaactagaagac
ttacccgttccgacaatctcagtacttaaaggtcacacacttggcggcggctgtgaatgc
gtactggctaccgacatgcgcatcggtgacaagaccaccagcattggcctaccagaaacc
aaactgggcatcatgccaggctttggtggttgtgtgcgtttgccgcgcgttatcggtgca
gatagcgcgatggaaatcatcacgcaaggcaaagcatgtcgtgcagatgaggccttgaag
attggtttattggatgccgtggttgaaactgatgcgttgtatgaatccgcattgcaaaca
ctgacttcagctatcaacgaaaagatcgattggcaagcacgtcgtaaacaaaaaacctcg
ccactgacactcagcaagctagagtcgatgatgagcttcacgatggcaaaaggcctagtg
gcacaaaaagcaggtccacactaccctgcgccaatgactgcagttattacgattgaagaa
ggcgcacgctttgcgcgtaacgaagcactcgacattgaacgcaaatacttcgttaaactc
gcgaaatcagaagaagccaaagctctggttggtctgttcctcaacgaccaacacatcaaa
ggcatcgcgaaaaaagcggcgaaatcagcaagcaaaaacactgagcgagcagcggtatta
ggtgcaggcatcatgggtggtggcattgcttaccaatctgcgctgaaaggcgtgccagta
ttgatgaaagacatcgcccaaccatctctcgatttaggcatgaccgaagcgtctaaactg
ctaaacaaacgccttgctcaaggtcgtatcgacggcttcaagatggcgggaattttggca
tcaattaccccaagcctacattacgcaggcatcgaaaactcagatgtgattgttgaagcc
gttgtcgaaaatccaaaagtaaaagcagcggtactgagcgaagtcgaatcgcacgctggt
gaagacaccgtcattacatcaaacacatcgacgattccaatcaacctattggcacaatca
cttaaacgcccagaaaatttctgtggtatgcacttctttaaccctgtgcatcgcatgcct
ttggttgaaatcatccgtggtgagaaaacttctgatgaaaccatcaaccgcgtagtggct
tacgcagcgaaaatgggtaaatccccaatcgtcgtgaacgactgtccgggattcttcgtc
aaccgcgtattattcccgtactttggcggtttcagcatgttgcttcgtgacggtgcagac
ttcactaaagtcgacaaagtcatggaacgcaaatttggctggccgatgggcccggcgtac
ttgcttgatgtagtcggcatcgatactgcgcaccacgcacaagcggtgatggcagaaggt
ttccctgagcgaatgggaaaacaaggtcgtgacgcgattgatgctctattcgaagccaac
aaatacggtcagaagaatggcaacggtttctacagctacaccattgataaaaaaggtaag
cctaagaaaaccttcactgaagatatcttgccagtactggcagacgtctgcgcggataaa
caagagttcgatgagcaaaccatcatccaacgtatgatgattccgatgatcaacgaagtg
gtgctgtgtctgcaagaaggcattattgcaactcctcaagaagcagatatggcgctggtt
tacggccttggtttccctccattccgcggcggtgtattccgctacctagacagcgtaggt
attgctgaatttgttgaaatggcaaaacagcacgctgatctaggcgcgatgtaccatgtt
ccgcaaatgttgattgatatggcggcgaaaggcgaaagcttctacggcgcgcaacagcaa
ggctctatctaa

DBGET integrated database retrieval system