KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0241Help
Entry
VPBB_0241         CDS       T02409                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00051  Fructose and mannose metabolism
vpb00520  Amino sugar and nucleotide sugar metabolism
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VPBB_0241
   00520 Amino sugar and nucleotide sugar metabolism
    VPBB_0241
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VPBB_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGB08765
Position
1:260291..261733
Genome map
AA seq 480 aa AA seqDB search
MLIPVIMAGGSGSRLWPLSRSKYPKQFLAVTGEQTMLQQTLSRMVGLEHNAPFVICNEEH
RFLVAEQLRRINGNHSGILLEPVGRNTAPAIALAAKFALSENQTSGEDALMLVLAADHVI
KDTQSFHQSVQAAIPYAQRGDMVTFGIKANAPETGYGYIKTGATVTAVDESRGFSVDRFV
EKPDLETAKQYLEDGSYLWNSGMFLFKASTYLEELAKFRPDILKACESAYDSHFDDLDFI
RMSSELFSQIPDESIDFAVMEKTEKAVVVPMDANWSDVGSWSALWDVNDKDEQGNATRGD
VLTEQTQNSYIYSQDKLVATVGVENLIVVETKDAVLVADKDKVQDVKSIVNQLKQQNRAE
CQQHQEVYRPWGSHETVSEGERYHVKQVLVKPKEKTALQMHHHRAEHWVVVSGTAKVTKG
DETFLLTENQSTFIPVGTPHSVENPGQVPLELIEVRSGSYLKEDDIVRFDEQASKFGGDY
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcttattcctgtaattatggccggcggctcaggcagtcgtttatggcctctatctcgt
tcaaaatatcctaaacaattccttgcagtaactggtgaacaaaccatgcttcaacaaacg
ttgagccgcatggttggtctagaacacaatgcgccgtttgtgatctgcaatgaagaacat
cgattcctagttgctgagcaacttcgccgtattaatggcaatcatagcggaatactctta
gagccagtagggcgtaatactgctcccgctatcgctttagcagcaaaatttgccctatct
gaaaatcaaacttcaggtgaagatgctttgatgttagttcttgctgctgatcatgtgatt
aaagatactcaatctttccatcaatcggtgcaagctgctattccgtacgcacaacgtggt
gatatggtcacttttggtatcaaagcgaatgcaccagaaacaggttatggctacattaaa
actggtgctacggttactgctgtggatgagagtcgaggctttagtgttgatagatttgtt
gaaaagcctgatctcgaaactgcaaagcaatatctagaggatggtagctacttgtggaac
agtggtatgtttttattcaaagcatctacttatcttgaagaattagcaaagttccgacca
gatatcttgaaagcatgtgaaagtgcttacgatagtcattttgacgacctagactttatt
cgtatgtcatccgaattgttctcacaaatcccagacgaatcaatagattttgctgtaatg
gaaaaaacagaaaaagctgttgttgttcctatggacgcaaattggagtgatgttggttct
tggtctgcactctgggacgtgaatgataaagatgaacagggcaatgcaactcgtggtgat
gtgttaactgagcagactcagaatagttatatttattcacaagataaacttgttgctacc
gttggtgtcgaaaaccttatcgtcgtagaaacaaaagatgcagtgctcgtcgctgataaa
gataaagttcaagatgtaaagtcgattgttaatcagctaaaacaacaaaaccgagcagag
tgtcagcagcatcaagaggtatatcgcccatggggttctcatgagacggtatctgagggt
gagcgttaccatgtgaagcaagtgttggttaagccaaaagagaagactgctcttcagatg
catcaccaccgagcagaacattgggtagttgtgtcaggtacggctaaagtgacaaaaggt
gatgaaactttccttcttactgaaaatcagtcaacttttattccagtgggaactccgcac
tctgtagaaaacccaggacaggtgcctttagagcttattgaagttcgttctggatcgtac
ttaaaagaagacgatattgttcgctttgatgagcaagcatctaagtttggtggtgactac
taa

DBGET integrated database retrieval system