KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1309
Entry
VPBB_1309         CDS       T02409                                 

Definition
(GenBank) TypeVI secretion Hcp protein, biofilm development
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VPBB_1309
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpb02044]
    VPBB_1309
Secretion system [BR:vpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VPBB_1309
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGB09796
Position
1:1467305..1467823
AA seq 172 aa
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPT
GQRVHRPLVVTKVQDRSSPLLFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALL
VDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccagcatatatgtctatcaacggtgaaactcaaggtcacattactaaagat
acatactctgcagattcagtaggtaacacatggcaagaagctcacgttgatgagttccta
gtacaagaacttgatcacgtgctaactgttccacgtgatccacaaagtggtcaacctact
ggtcaacgtgtacaccgtccacttgttgtgactaaagttcaagaccgttcttctccacta
ctatttaacgcattagtgtctggtgaaaaacttcctgagtgtttgattcgtttctaccgt
acttcagttcaaggcaagcaagagcactactactcaatcaagctgattgatgcgctattg
gtagatatccaaactcgtatgaaccactgtcaagatgcagcaacagctgatcgcgttaca
gaagaagttcttaagtttacttaccgtgcaatcgaagtaactcacgaaaactgtggtaca
gctggtaacgacgactggcgtgctccacgcgaagcataa

DBGET integrated database retrieval system