KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2138Help
Entry
VPBB_2138         CDS       T02409                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpb03016]
    VPBB_2138
Enzymes [BR:vpb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     VPBB_2138
Transfer RNA biogenesis [BR:vpb03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    VPBB_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGB10601
Position
1:complement(2372885..2373652)
Genome map
AA seq 255 aa AA seqDB search
MSEQETSQTVAPVELEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHV
FPLHRLDRPTSGVLVFALSSEVASQVMPMFAEHKMEKTYHAIVRGWIEEEGVLDYALKVE
LDKIADKFASQEKEAQEAVTAYKPLAKVEVPYSTGKFPTTRYCLMEMKPKTGRKHQLRRH
MAHLRHPIVGDTSHGDGKHNKLFRNEFDSQRLLLHASELRFVHPFTNEELVMKASIDDTW
QQLFTRFEWDEELVK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaagaaacatcacaaaccgtggctccagtagagttggagattgtttatcaa
gatgagtattttgttgcggtgaacaagcccgccggcatgttggttcatcgcagttggcta
gataaacacgaaactcagtttgtcatgcagactctgcgagaccaaattggtcagcatgtc
tttccgttgcatcgcttggatcgtccgacttctggcgttttggtgtttgcgctctccagt
gaagtggcttctcaagtgatgcctatgtttgctgagcacaaaatggaaaagacctatcac
gcgattgttcgtggttggattgaggaagagggcgttttagattacgcgttaaaagtcgaa
ttagacaaaattgcagataagttcgcctcacaagagaaagaagctcaagaggccgtaacc
gcttacaaaccactggcgaaggtggaagtgccttattcgacgggcaagttcccaacaacg
cgctactgtttgatggaaatgaagcccaagactggtcgcaagcaccaattgcgtcgtcac
atggcccacctacgtcacccaattgtgggggacacatcgcacggtgatggtaaacacaac
aaattgttccgtaacgaatttgattcacagcgcttgctgttacatgcttcggagctgcgt
tttgtgcatccgtttacaaatgaagagctggtgatgaaagcgagtatcgacgatacgtgg
cagcaattgtttactcgatttgagtgggacgaagagctcgttaagtaa

DBGET integrated database retrieval system