KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0566Help
Entry
VPBB_A0566        CDS       T02409                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00071  Fatty acid degradation
vpb00280  Valine, leucine and isoleucine degradation
vpb00310  Lysine degradation
vpb00362  Benzoate degradation
vpb00380  Tryptophan metabolism
vpb00620  Pyruvate metabolism
vpb00630  Glyoxylate and dicarboxylate metabolism
vpb00640  Propanoate metabolism
vpb00650  Butanoate metabolism
vpb00900  Terpenoid backbone biosynthesis
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb01130  Biosynthesis of antibiotics
vpb01200  Carbon metabolism
vpb01212  Fatty acid metabolism
vpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPBB_A0566
   00630 Glyoxylate and dicarboxylate metabolism
    VPBB_A0566
   00640 Propanoate metabolism
    VPBB_A0566
   00650 Butanoate metabolism
    VPBB_A0566
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VPBB_A0566
   00072 Synthesis and degradation of ketone bodies
    VPBB_A0566
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPBB_A0566
   00310 Lysine degradation
    VPBB_A0566
   00380 Tryptophan metabolism
    VPBB_A0566
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VPBB_A0566
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VPBB_A0566
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VPBB_A0566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpb04147]
    VPBB_A0566
Enzymes [BR:vpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VPBB_A0566
Exosome [BR:vpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPBB_A0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Lumazine_bd_2
Motif
Other DBs
NCBI-ProteinID: AGB11940
Position
2:611558..612784
Genome map
AA seq 408 aa AA seqDB search
MGNDIWIVSAKRTPIGRFQGLLQPYSATQLGAFAIKAAMKSLGENVLSETVIDEVLMGCV
LPAGCGQAPARQAALGAGLPPSTGCTTINKVCGSGMKSVMLAHDLIKAGTIRTAVAGGME
SMTNAPYLLKEARNGMRLGHHSTYDHMFLDGLQDAYEGHLMGVYAQQIADRLKFSREKMD
EWATMSAKRALEAQERGLFDDEIAPIDIRTKTATTHLDYDEHPRSIDLEKIPQLKPAFDK
KGSVTAANSSAISDGAAALILMDEETARHQNLTPLAIIKSHATHARKPDEFTLAPVYAIE
QLLSQLDWSIDEIDLWEINEAFAVVTQIAVAELGLDSSKVNIKGGACALGHPIGASGARI
LVTLIHSLRQLQALGIDGDASNKKVMRGVASLCIGGGEATAIGIEIPL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgacatttggattgtcagtgcgaaaagaacgccaattgggcgctttcaaggg
ctgttgcaaccgtactccgcaacgcagttaggcgcatttgccataaaggccgcgatgaaa
tcgctgggtgaaaacgtactttctgagaccgtaattgatgaagtgttgatgggctgcgta
ctaccagccggatgcggacaagcgccggctagacaggcagcgctcggtgcgggtttacca
cccagtacagggtgcacaaccatcaataaagtttgcggttcgggaatgaaaagcgtcatg
cttgctcatgatttgatcaaagctggcactattcgaacggctgttgctggaggtatggaa
agcatgacgaatgcgccctatttgttgaaagaggcgcgcaatggcatgcgattagggcat
cactccacttacgatcacatgtttctcgatggattgcaggatgcctacgaagggcacttg
atgggcgtctatgctcagcaaattgcagataggctcaaattcagccgtgagaaaatggat
gagtgggcaaccatgtctgcaaaacgagcgttagaagcgcaagagcgtggtttgtttgat
gatgaaattgcaccaattgacatccggacaaaaactgccacaacccatctcgattatgat
gagcatcctcgctccatcgatctagaaaaaattcctcagctcaaacccgctttcgataaa
aaaggctcagtgactgcggcgaactccagtgccatttccgatggtgcagccgcgttgatt
ttgatggatgaagagacggcgcgccaccaaaatcttaccccgcttgccattatcaaatcg
cacgcgactcacgcgagaaagccggatgagtttacgttggctccggtctacgccattgaa
caactgttgtcgcaattggattggtcgattgacgaaattgatctctgggaaatcaacgaa
gcctttgcggtagtgacacaaattgcggttgcggaattagggcttgattcaagcaaggtc
aatattaaaggcggagcttgtgcgctcgggcatccaattggtgccagtggggctcgaatt
ttggtcacattgatccacagtttaagacagctacaagcactggggattgatggggatgca
agcaacaagaaagtgatgcgaggcgttgcgtcactgtgtattggcggtggcgaggcgaca
gcgataggtatcgagatcccgctgtaa

DBGET integrated database retrieval system