KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0920Help
Entry
VPBB_A0920        CDS       T02409                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00260  Glycine, serine and threonine metabolism
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb01130  Biosynthesis of antibiotics
vpb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VPBB_A0920
Enzymes [BR:vpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VPBB_A0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGB12294
Position
2:1034282..1035286
Genome map
AA seq 334 aa AA seqDB search
MDFRSDTVTQPTQAMREAMFSAPVGDDVYGDDPTVNELEQFAAELAGFEAALFTTSGTQA
NLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLPFDKLEAAIK
PDDAHFARTRLLSLENTINGKVIPLSYLAEAREFVNKHNLKLHLDGARVFNAAVALDVPV
KEIGQYFDSMTICLSKGLAAPVGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKLA
ITEQVAQLKQDHINAKALAEGLAELPGFSVNPDFVQTNIVFAKLDAKVDIQSIAEQLKQQ
NIIISPGNPIRFVTHKDISAEDIQTFLSSLKSLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgttcagacacagtgactcaacccacccaagctatgcgcgaagcaatgttc
agcgcccctgttggcgatgatgtttatggtgacgatcctaccgtaaacgagctagagcaa
ttcgcggctgaattagcagggtttgaggcagcgttgtttaccacttctggcacgcaagca
aaccttttagggttaatggcgcattgtgagcgtggcgatgaatatttatgcggccagcaa
gcacacaattacaaatatgaagcaggtggcgcagcggtactgggttctatccagcctcaa
ccaatagaaaacaatccagatggcacgttgccatttgacaaattagaggcggcaattaaa
cctgatgacgcgcactttgctcgtactcgtctgctaagtttagaaaacaccatcaacggt
aaagtgatcccactgtcttacttagcggaagctcgtgaattcgttaataaacacaatctg
aaactgcatctcgacggtgctcgtgtgtttaacgcagccgttgcgctcgatgttcccgtc
aaggagattggtcaatactttgattccatgacgatttgtttatcgaaaggtcttgcggca
cccgttggttcactgctgcttggcagcaaggaatacatcgcgaaagctcgccgtttaaga
aagatggtcggtggcggaatgcgtcaggcaggtattttagcggcagcaggtaaactggcg
atcacggaacaagtcgcgcagttaaagcaagatcacatcaatgcaaaagcattggcggaa
ggtttagctgaactaccgggtttctcggtaaatcctgacttcgttcaaaccaacattgtg
tttgctaagttggatgctaaagtcgatatccaaagcatcgcggagcaactcaagcaacaa
aacatcatcatcagcccaggaaacccaattcgctttgtcacacacaaagacatctctgct
gaagatattcaaaccttcctatcgagccttaaatctctgctttag

DBGET integrated database retrieval system