KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0932
Entry
VPBB_A0932        CDS       T02409                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VPBB_A0932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpb02044]
    VPBB_A0932
Secretion system [BR:vpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VPBB_A0932
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: AGB12306
Position
2:complement(1048650..1050485)
AA seq 611 aa
MKKASQDNNFIRISSPFGKDALILNLFEYREGISELFSLRAKAYFNDQKNELNEIVGKEV
TISVENSSRVSKSPRFFHGIVSAAKLEGQRVMNSHNGENYKNIEIIVEPKVKFAAYRNNC
KIFQKKNIKDIISEVLSEHGVAFKFELKNTYPQYSYKVQYEESDLAFVQRLLAEEGLSFC
FSHSKSSHVLDIFDDVSFYKPSPEFMVDFDTGSSESSHISAWNETQVLTTKSSQKSGFNM
LKPASQPKNVAAGDTALFTVPASEYFEYLGETESDDQYSLRNTHAIESLQQNVYLCSGEA
SCRTFSVGKCFKFKKHEDKSRVGKEYVLASVTIFASVFNQTGLGGTASQGVRVAFTCVDS
KTILRPAVTYPKPQIKGLQTAIVTGNKDGEVYVDKHGRIKVQFHWDRLGKYDVNSSCWIR
VAQSVAGNGWGAVFHPRVGQEVIVEFVNGDPDQPIVTGALYNGSQLPPYSLPEKSSQSGF
KSRSVQKGNANFNELRFEDKPGEEHIYLHAEKLFQMLVEDCVDIVVENNKVEKVTNDVTQ
DVGKNAMLKVGENYTSDTGKVLSLNAGKSIEIKVGGASIQMSSSGEINIKGNKISINGSA
IALKAGQISLN
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgaaaaaagcaagtcaagacaacaactttatccgtatttcttctccgtttggaaaagat
gctcttattctcaatttgttcgaatatagagaagggatctcggagcttttttcattgcgt
gctaaagcttattttaatgatcaaaaaaatgagctcaatgaaatcgtgggtaaagaagta
acgatttcagtagaaaatagtagtcgtgtttctaaaagtccgcgttttttccatggcatt
gtctctgctgcaaagctcgaaggccagagagtgatgaattctcataatggagaaaactac
aaaaatattgaaattattgttgaaccgaaagttaagttcgcagcgtacagaaataattgt
aagatctttcagaagaaaaatataaaagacattatttccgaagtgctttcagagcatggt
gttgcatttaaatttgaactaaaaaatacgtatccccaatattcctacaaagttcagtat
gaagaatctgatcttgcttttgttcagcgcctcctagccgaagaagggctctctttttgc
tttagtcactctaaatcatcccatgtcctagatatttttgatgatgtaagtttttacaaa
cccagtcctgagtttatggtcgatttcgatacaggcagttcagagtcgagtcacatttct
gcttggaacgaaacacaagttttaacgactaaatcaagccagaagtctggcttcaatatg
ctaaaaccagcctcacaacccaaaaacgtagctgctggtgatactgcactgtttaccgta
cctgcgagtgagtattttgagtatctgggtgaaacagaaagtgacgatcagtactcgctt
cgaaacactcacgcaattgaatcccttcaacagaacgtttatctatgtagcggagaggcg
agttgtcgaaccttttctgtgggtaaatgttttaagttcaaaaaacacgaagataaatcg
cgagtaggaaaagaatatgtcttggcctctgtgacgatttttgcttctgtgtttaatcaa
actggtctgggtggcaccgcttctcaaggtgttcgtgttgcgtttacttgtgtggactct
aaaaccattttaaggccagcggttacttaccctaaaccgcaaattaaaggtcttcaaaca
gccattgtgactggtaataaagacggtgaggtatacgttgataaacatggaagaataaaa
gtacagttccattgggatcgtttgggtaagtacgatgtaaatagttcgtgttggattcga
gttgctcaaagtgttgccggaaatggatggggtgcggtgtttcatcctcgggtagggcaa
gaggttatcgtagagtttgtgaatggcgacccagatcaacctattgtcacgggtgcgctg
tataacgggagccagttgcccccgtattctcttccagagaaaagttctcaaagcggtttt
aagtcccgctcagttcaaaaaggaaacgccaatttcaacgagttacgctttgaagataaa
cctggcgaagaacacatttaccttcacgcagaaaagttgttccaaatgttagtcgaagac
tgcgtggatattgtggttgagaacaataaagttgagaaagtaaccaacgatgtaactcaa
gacgttggaaaaaatgcgatgttaaaggtgggagagaactatacctctgacactggaaaa
gtgttgtccctcaatgcagggaaaagtattgaaattaaagtcggtggagcctcaattcaa
atgtcgagttctggcgaaatcaacattaagggcaacaagatttctatcaatggctctgca
atcgcattgaaagcaggacaaatctctttgaattaa

DBGET integrated database retrieval system