KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0939
Entry
VPBB_A0939        CDS       T02409                                 

Definition
(GenBank) Uncharacterized protein ImpD
  KO
K11899  type VI secretion system protein ImpD
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpb02044]
    VPBB_A0939
Secretion system [BR:vpb02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VPBB_A0939
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AGB12313
Position
2:complement(1057869..1059380)
AA seq 503 aa
MTKIDALNFLDPEELTHEFTPMGLAEFDSHWLTQFVECSDSTLAARIWLEGTQSKDFASF
RHSIVSTINTIDTLLQKQLNEIIHHPDFQKLECSWVGVRYLCEQVDKPSSDSVKIKVLSA
TWNEVSKDALKAIEFDQSALFKLLYQNEYGMAGGEPFGVVVGDYQLRYDPRTNYFDRDIS
VLSKISQSAAAAFSPFVMSASPEIFGVNTFAELSSTRDVAAQFEQIDYVKWRQLRDNDDT
KFIGLTAPNVLFRQPYKSDGSRNDQFEFQENIDDSNNDLLWGSGAFCFAAVSIRAFQEHG
WFTHMRGIKQGDYSQGIIVAPTRNKTRINGKNDRDRCPLNLKVSERKEQELSDCGFIPIS
PVPETDMVGMTSNVSLHKPKLYEEKHVATNAKLTSMLQYTMCVSRIAHYVKVMGRDKIGG
YQDAASLEREFQTWLHQYTTASDEASDELRAKYPLNEAKIKVREKRDTPGHFYSVIHLRP
HFQLDQMVSSIKLITELSPEHLV
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgacgaaaatagatgcattgaactttctagacccagaggaactcacacacgagtttaca
ccgatgggcctggctgagtttgacagtcattggttgactcaatttgttgaatgttcagat
tcaacacttgcggcacgaatttggttggaaggtacgcaatctaaagattttgcgagtttt
cgccatagcattgtgagcacgattaatactattgacacactattacagaagcagctcaat
gagatcattcatcatccagattttcagaaattagagtgcagttgggtaggtgttcgatat
ttatgtgaacaagttgataaaccgtcgtctgactcagtaaaaattaaagttctatctgca
acatggaatgaagtaagtaaagatgcgctcaaggctatcgaattcgatcagtctgccttg
tttaaattactctatcaaaatgaatatggaatggccggaggagaaccctttggtgtggtt
gttggtgattatcaattacgttatgacccgagaacaaattattttgatagagatatctct
gtgctaagcaagatatctcagtctgctgctgcggcatttagtccatttgtaatgtcagcg
tctcctgaaatattcggtgtgaacacatttgccgaactttcgtcgactcgagacgttgct
gcgcaatttgaacaaattgattatgtcaaatggagacagttgcgagataacgatgatacc
aagtttattggcttaaccgctcctaacgtgctttttcgacaaccctacaaaagtgatggt
tctcgaaacgatcaatttgaatttcaagagaatattgacgattcaaataacgatttattg
tggggaagtggagccttctgtttcgctgctgtttcgataagagcattccaagagcacggt
tggtttactcatatgcgaggaataaagcagggggattatagtcaaggcattattgttgct
cctacaagaaacaaaacgcgcattaatggcaaaaatgacagagatagatgccctttaaat
ctaaaagtctctgagcgtaaagagcaagaactgtctgattgtggattcattccgatttca
ccagttcctgaaacagacatggttggcatgacttccaatgtttcgttgcataagccaaaa
ctgtatgaagagaagcatgttgcgactaatgcaaaactcacctcaatgctccaatacacg
atgtgtgtatcgcgtatagcacactacgtcaaagttatggggcgagacaagataggtggt
tatcaggacgcggcatcgctcgagagggagtttcagacttggttacatcaatatacaacg
gcttcagacgaagcttcggatgaactcagagctaagtacccattgaacgaagcgaagatc
aaagttagagagaaacgcgatacgccagggcacttctactcggtgatacatttacgtcct
cattttcagctcgaccaaatggtctcaagtatcaaattaattacggaattatcaccagaa
catttggtgtaa

DBGET integrated database retrieval system