KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0940
Entry
VPBB_A0940        CDS       T02409                                 

Definition
(GenBank) Uncharacterized protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpb02044]
    VPBB_A0940
Secretion system [BR:vpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VPBB_A0940
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AGB12314
Position
2:complement(1059436..1060929)
AA seq 497 aa
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTV
TFREAINLLDRQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKE
LHKDLSKAVEFDQSQIFKKVYESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAA
SGFSPFLSAASPALFGFDEWTELSKPRDLDKVFESLEYAQWRSFRESADSRFVSLTMPKV
LARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCWMNSSYVLGVKLTDAFSKYGF
CTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLGFLPLCHYKNT
NYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQME
ELTTSLRLVAKIPQSGG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacgactcaagttgaaaaacaactcgatcctacggtgggtgaacaaaccacttcattt
cttgaacaggctattggtgcgacgaaacaaacagaagcatcgagagcagaagagctgatc
aagacactgactgaagaagcgatgaaggggacggtttcttggaataaaaacctaaccgta
actttccgtgaagcgatcaatttgcttgatagacagatttcagagcagctttctgaagtt
atgcaccatcctgagctacaaaagttagaaggctcatggcgtgggctgaattacttagtc
atgaattctgagacaagttctacgctgaaaattcgcatgatcagcatcacgaagaaagag
cttcataaagacttaagtaaagcggttgaattcgatcaaagtcaaatctttaaaaaagtg
tacgaatctgaatttggtagcgctggtggtgaaccgtatggtgctttaattggtgactac
gagtttacaaaccatccagaagatattgagtctttgcgtttaatgtcgaatgttgctgct
tcgggtttctcaccattcttgtctgctgcttctcctgcgctatttggttttgatgagtgg
acagaactatctaaaccgcgcgatttagataaagtctttgagtcgttggaatatgcgcaa
tggcgctctttccgtgaaagtgcagattctcgttttgtaagcttaacgatgcctaaagta
ttagctcgcttgccatacggccaagctacctctcctgtagaagcgtttggctttgaagag
tttgatgtggatcctgtgtcgggtatcgccgttaatgctgatcacaatgattattgttgg
atgaactcatcgtacgtgcttggcgtcaaactgacggatgcattttctaagtatggtttc
tgtactgctattcgtggcgcagagggtggtgggcgagttgataacttaccaacacacttc
ttcatgagtgatgatggtgacccagatatgaagtgcccaacggaaattggcattacagac
cgccgtgaagcggaattgggtaaactgggtttcttaccgttgtgtcactacaaaaatacg
aactatgccgtgttctttggtgctcaaacttgtcaaaaaccagcaaatcatgaatctcca
gaagtggcagcaaacgcggcaatttcagcaagacttccttacatgatggcaacctctcgt
tttgcacattatttgaaagtaatggctcgagacaagatcggtagctttatggaagcagaa
gacgttgaatcttggttgaaccgttggattcttggctatgtgaacgcttctgaaggtggc
ggtcaagaaattcgtgcgaaataccctcttgccgacgctcgcgtacaagttaaggaaatt
ccaggttctcctggttcttacaacgcggttgcttggctcaagccatggcttcaaatggaa
gagctaaccacgtctttaagactcgttgctaaaattcctcagtcgggtggctaa

DBGET integrated database retrieval system