KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A1104Help
Entry
VPBB_A1104        CDS       T02409                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00071  Fatty acid degradation
vpb00280  Valine, leucine and isoleucine degradation
vpb00310  Lysine degradation
vpb00362  Benzoate degradation
vpb00380  Tryptophan metabolism
vpb00620  Pyruvate metabolism
vpb00630  Glyoxylate and dicarboxylate metabolism
vpb00640  Propanoate metabolism
vpb00650  Butanoate metabolism
vpb00900  Terpenoid backbone biosynthesis
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb01130  Biosynthesis of antibiotics
vpb01200  Carbon metabolism
vpb01212  Fatty acid metabolism
vpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPBB_A1104
   00630 Glyoxylate and dicarboxylate metabolism
    VPBB_A1104
   00640 Propanoate metabolism
    VPBB_A1104
   00650 Butanoate metabolism
    VPBB_A1104
  Lipid metabolism
   00071 Fatty acid degradation
    VPBB_A1104
   00072 Synthesis and degradation of ketone bodies
    VPBB_A1104
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPBB_A1104
   00310 Lysine degradation
    VPBB_A1104
   00380 Tryptophan metabolism
    VPBB_A1104
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VPBB_A1104
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VPBB_A1104
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VPBB_A1104
Enzymes [BR:vpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VPBB_A1104
Exosome [BR:vpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPBB_A1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGB12478
Position
2:complement(1246910..1248121)
Genome map
AA seq 403 aa AA seqDB search
MMEKVFIVAAKRTPIGAFGGSLKNTSAGDLAAVAIKGALEAAKLAGDKVDEVIVGNVVGA
GQGMGVGRQAALFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAEIVVAAGVEVMS
QIPFAAPSSIRDGNKMGNLELKDLLVADGLTDVYNQYHMGVTAENVAKEIGLTRQQQDEY
ALSSQQKAVAAIEAGKFKDEIVPVEVQQRRETVLFDTDEYPKANATMEALSKLRPAFDRE
GTVTAGNASGINDGASAIIVASESAVKAHGLTPLAEIVSYAQSGLDPKIMGLGPVESVNK
ALAKAELTVNDIDVYELNEAFAAQALGVIHQLAETNQVPVNAIQDKANFNGGAIALGHPL
GASGNRILVTLVHELHKQNGQYGVASLCVGGGMGTAVVVKAVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaagtatttatcgtagcggcgaagcgtaccccaatcggcgcttttggtggc
agcctgaaaaatacctcagctggcgatctggcagcagtagcgattaagggcgcgttagaa
gcagcaaagttggctggcgacaaggttgacgaagtgattgtcggcaacgttgttggtgca
ggtcaaggcatgggtgtaggccgccaagccgcattgtttgctgggattcctgaatctgtt
cctgcatatggcgtaaacatggtttgtggtagtggtatgaaaacggtcatggacgcagtt
tctcatatccgtagtggcgatgcagagatcgttgttgcagcgggtgttgaggtcatgtct
cagattccgtttgccgcaccaagcagcattcgtgatggcaataaaatgggcaatctggag
ctgaaagatctgctcgtagcggacggtttaaccgacgtttacaaccaatatcacatgggt
gtgacggcagaaaacgtagcaaaagaaatcggcctaactcgtcaacagcaagacgaatat
gcgttgtcgagccaacagaaagcggttgccgctattgaagcaggtaaattcaaagacgaa
attgtgccagtggaagtgcaacagcgtcgagaaaccgtactattcgataccgatgaatac
ccaaaagcgaacgcaacaatggaagctttaagcaagctgcgtcctgcttttgaccgcgaa
ggcacagtgactgcgggtaatgcgtcgggcattaacgatggcgcgagtgcgattatcgtt
gcgtctgaaagcgcagttaaagcgcacggattaacgccgcttgctgagatcgtaagctac
gcgcaatcgggtcttgatccgaagatcatgggcttaggtccagttgagtcggtcaataaa
gcactcgcaaaagcggaactcacagtaaacgacatcgacgtttacgagttaaacgaagca
tttgcagcgcaagcacttggcgtgattcatcagttggcggaaaccaaccaagttccagtt
aatgcgattcaagataaagcgaactttaacggcggtgctatcgcgctaggtcacccgctt
ggtgcatcgggcaatcgaattttagtgacgcttgttcacgagcttcataagcaaaatggt
caatatggtgttgcttcactttgtgtgggcggcggcatgggcacggctgtggttgtaaaa
gcagttaagtaa

DBGET integrated database retrieval system