KEGG   Variovorax paradoxus B4: VAPA_1c02460Help
Entry
VAPA_1c02460      CDS       T02835                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
vpd  Variovorax paradoxus B4
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpd02044]
    VAPA_1c02460
Secretion system [BR:vpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAPA_1c02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AGU47376
UniProt: T1X4K4
Position
1:258416..259792
Genome map
AA seq 458 aa AA seqDB search
MTVRNPGAGKHGALPQALANRVVWSEGMYLRPQHFQQLERYVEQYVTRRTAGLQGAYWGW
LSLDIDRDAHALGRVSLLGGAGVLPDGTPFSFGAEDAPLPYEVPSDLTDELIVLALPLRR
TGSEEILFADDEGSAARFGVIEREVADGNSVALGPAVLQLAKPRLRLARASSLTAEWQAI
GAVRVIERRTDHKLVIDANYIPPVLDASAHPMLRSMVSELHGLLTQRSEALASRLSQPGR
GGVSEVSDFLLLELVNRYLALTWHAQHAVQVHPEELFVDWFKLACHLATHTSPTRRPVVW
PKYDHDNLNETIRPLMEELRRSLSAVLEQSAIAIELEERSHGVRVGRMPDPVLVRNAGFV
LAVHANLPADAIQQRFPTQVKIGSVERIRDLVQLQLPGVTVRPLPVAPRQIPYNAGYHYF
ELDKSGDMWRQLEKSGGVAMHLAGDFPGLAMEFWAIRP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttcgcaatccgggcgccggcaagcatggcgcccttccgcaggcattggcgaat
cgcgtggtgtggtccgaaggcatgtacctgaggccccagcatttccagcaactggagcgc
tatgtcgagcagtacgtcacgcgccgtaccgcgggcctgcaaggtgcctattggggatgg
ctcagcctggacatcgatcgcgatgcccatgcactcggacgcgtgtcgctgctcggcggc
gccggcgtgctgcccgacggcacgccgttctcgttcggcgccgaagatgcgccgctgcct
tacgaggtgccgagcgacctgaccgatgaactcatcgtgcttgcgctgccgctgcgccgc
accggcagcgaagagatcctcttcgccgacgacgagggatcggccgcgcgcttcggcgtg
atcgagcgcgaggtggccgacggcaattcggtggcgctcggcccggcggtgctgcagctt
gcgaagccgcgcctgcgccttgcgcgcgcgtcgtcgctcacggcggagtggcaggccatc
ggtgcggtacgcgtcatagagcggcgcaccgaccacaagctggtgatcgacgccaactac
attccgccggtgctcgatgcatcggcgcaccccatgctgcgcagcatggtttccgagctg
cacggcctgctcacgcagcgctccgaggccctggcctcgcggctctcgcagcccggccgc
ggcggcgtgagcgaggtctccgactttctcctgctcgaactcgtcaaccgctatctcgca
ctgacctggcatgcgcagcatgcggtgcaggtgcaccccgaggaactgttcgtcgactgg
ttcaagctggcctgccatctggccacgcacacctcgcccacgcggcgccccgtggtgtgg
ccgaagtacgaccacgacaatctcaacgagacgatccggccgctgatggaagagctgcgg
cgctcgctctcggccgtgctcgagcagagcgccatcgccatcgagctggaggagcgcagc
cacggcgtgcgcgtgggccgcatgcccgatccggtgctggtgcgcaacgcgggcttcgtg
cttgcggtgcatgccaacctgcccgccgatgccatccagcagcgctttccgacgcaggtc
aagatcggttcggtggagcgcatccgcgacctcgtgcagctgcagctgccgggcgtcacg
gtgcggccgctgccggtggcgccgcgccagattccatacaacgcgggctaccactatttc
gaactcgacaagagtggcgacatgtggcgccagctcgaaaaatcgggcggcgttgcaatg
cacctggccggcgacttcccgggcctggccatggagttctgggcaattcgtccgtga

DBGET integrated database retrieval system