KEGG   Variovorax paradoxus B4: VAPA_1c02650Help
Entry
VAPA_1c02650      CDS       T02835                                 

Definition
(GenBank) type VI secretion system protein, Vgr family
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VAPA_1c02650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpd02044]
    VAPA_1c02650
Secretion system [BR:vpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAPA_1c02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C
Motif
Other DBs
NCBI-ProteinID: AGU47395
UniProt: T1X5E4
Position
1:complement(281747..284032)
Genome map
AA seq 761 aa AA seqDB search
MPTGTAQLARVLSVSSSAMPMLGGEPALEPIAIEGDEGLSRLFHYTLTLATPEQPGYNER
QAANVAIKQLVGEALTAHIVLDGRPGSGPQRRHLSGLVTRVRFLRLENRRALYEAVIEPW
LTLGTRTSDYRIFQNQNVLDIVREVLGKYGLPFDVRAVRSYPPREFQVQYGESDYDFVAR
LLHEWGLYFYFEHEESSHKLVIVDDMASHQPFAHAGYQRIPFHAAEATVREEHCDRFNAC
EALQSGRWVIGDFDFKRPKAELQQVSAMPRKTAQNTWERYGWPGDYVVESEGEQLVRTRM
EETGSQGERAGGSGNLRAVVPGCLVTLERHPQNESNREYLVTDARLRLQDVGDASAQQEF
ECRVDFEVIPTSKVFRASAPPVPRPRTTGPQTAIVTGPAGREIWTDEYGRVKLSFHWNRY
CTKDENSSCWVRVSSPWAGTNFGGIQIPRIGQEVIVDFENGDPDRPIVTGRVYNADNMPP
WTLPDNATQSGLLTRSSEGATDANANALRFEDKKGQEQLWLHAERNQDIEVERDETHWVG
NDRTKTIDRDETVHVKHDRTETVDHDETITVHNNRTETVDGNETITIHKNRTETVDLDET
ITVHKNRTETVDLNETIGIGMNRTETVGMNETIDIGDNRVVTIGGNKAETVALAKAETIG
LAKALTIGLGYQVSVGAAMNTSVALMQTEQVGRSKRVDVRNTFDITAGDEFSITVGKSTL
VMKSDGTITFNGHTFNVGTSGEQYFNADGHITSKANKIQEN
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaggcaccgcacagcttgcgcgcgttctcagcgtttcatcgtcggccatgccc
atgctgggcggcgagccggccctggagcccatcgccatcgaaggcgacgaagggctcagc
aggctgttccattacaccctgaccctggccacccccgagcagcccggctacaacgaacgc
caggccgccaacgtggccatcaagcagctggtgggcgaggcgctcacggcgcacatcgtg
ctcgatggacgcccgggctcgggcccgcagcggcgccatctctcgggccttgtgacgcgc
gtgcgcttcttgcgtctggagaaccggcgtgcgctgtacgaagccgtgatcgagccctgg
ctcacgctgggcacgcgcaccagcgactaccgcatcttccagaaccagaacgtgctggac
atcgtcagggaggtgctcggcaagtacgggcttcccttcgacgtgcgggccgtgcgcagc
tatccgccgcgcgagttccaggtgcagtacggcgaaagcgactacgacttcgtcgcacgg
ctgctgcacgagtggggcctgtacttctacttcgagcacgaagagagcagtcacaagctg
gtgatcgtcgacgacatggcgtcgcaccagcccttcgcccatgcgggctaccagcgcatt
cccttccatgcggcggaggccaccgtgcgcgaggagcattgcgaccgcttcaacgcctgc
gaggcgctgcaaagcggccgctgggtgatcggcgacttcgacttcaagcgcccgaaggcc
gagctgcagcaggtcagcgccatgccgcgcaagacggcgcagaacacctgggagcgctat
ggctggccgggcgactacgtggtggagtccgaaggcgagcagctggtgcgcacgcgcatg
gaagagaccggcagccagggcgagcgcgccggcggctcgggcaacctgcgcgcggtggtg
ccgggctgcctggtcacgctggagcgccatccccagaacgagtcgaaccgcgagtacctg
gtgacggacgcccgcttgcggctgcaggacgtgggcgatgccagtgcgcagcaggaattc
gagtgccgcgtcgatttcgaggtgattccgacgagcaaggtgttcagggcatcggccccg
ccggtgcccaggccgcgcaccacgggcccgcagacggcgatcgtcacgggcccggccggc
cgcgagatctggaccgatgaatacggccgcgtgaagctcagcttccactggaaccgctac
tgcacgaaggacgagaacagctcgtgctgggtgcgcgtgtcctcgccctgggccggcacc
aatttcggcggcatccagatcccgcgcatcggccaggaggtgatcgtcgacttcgagaac
ggcgaccccgaccgccccatcgtcacggggcgcgtctacaacgccgacaacatgccgccg
tggaccctgccggacaacgccacgcaaagcggcctgctcacgcgcagctccgaaggcgcg
accgatgccaatgccaatgcgctgcgcttcgaggacaagaagggccaggagcagctgtgg
ctgcatgcggagcgcaaccaggacatcgaggtcgagcgcgacgagacgcactgggtgggc
aacgaccgcaccaagaccatcgaccgcgacgaaaccgtgcatgtgaagcacgaccgcacg
gagaccgtcgatcacgacgagaccatcaccgtccacaacaaccgcaccgagacggtcgat
ggcaacgagacgatcacgatccacaagaaccgcaccgagaccgtggacctcgacgagacc
atcacggtgcacaagaaccgcaccgagaccgtcgacctcaacgagaccatcggcatcggc
atgaaccgcaccgagacggtgggcatgaacgagaccatcgacatcggcgacaaccgcgtg
gtgaccatcggcggcaacaaggccgagacggtggccctggccaaggccgagaccatcggc
cttgccaaggcgctgaccatcggcctgggctaccaggtgtcggtgggcgcggcaatgaac
accagcgtggcgctgatgcagaccgagcaggtcgggcgctccaagcgcgtcgatgtgcgc
aacaccttcgatataaccgcgggcgacgaattcagcatcacggtcggtaagtccacgctg
gtgatgaagtccgatggcaccatcaccttcaacggccacaccttcaacgtcggcacgagc
ggcgagcagtatttcaacgccgatggacacatcacgtcgaaggcgaacaagatccaggag
aactga

DBGET integrated database retrieval system