KEGG   Variovorax paradoxus B4: VAPA_1c06030
Entry
VAPA_1c06030      CDS       T02835                                 

Definition
(GenBank) putative type VI secretion system protein, lysozyme-like protein
  KO
K11897  type VI secretion system protein ImpF
Organism
vpd  Variovorax paradoxus B4
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpd02044]
    VAPA_1c06030
Secretion system [BR:vpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAPA_1c06030
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AGU47733
UniProt: T1X569
Position
1:662430..662945
AA seq 171 aa
MAELTAQERLQPSLLDRLVDDAPSEKRESDERRTLTKQALRSAVLRDLSWLFNATGFGLA
MDDKQYPNAARSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQFEPRILSRTLEVELVM
EGSALDSHNSIGLQIRGMLWAQPVPLEFLMRSRVDLEEGRIEIVDMAQNPR
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccgaactcaccgcccaggaacgcctgcagccgtcgctgctcgaccgcctggtcgac
gacgcgcccagcgaaaagcgcgagagcgacgagaggcgcacgctcaccaagcaggcgctg
cgctcggccgtgctgcgcgacctgagctggctcttcaacgccaccggcttcgggcttgcc
atggacgacaagcaatacccgaacgccgcacgctcggtcatcaactacggattgcctatg
ctgtctggccagttcacctcgtcggtgcagcgtgtcagcatggaacaggctttgaagaac
gcaatcctgcagttcgagccgcgcattttgtcccgcactctcgaagttgaactcgtcatg
gaaggctcggcactcgactcgcacaacagcatcggcctgcagatccgcggcatgctgtgg
gcgcagcccgtgccgctcgagttcctgatgcgaagccgtgtagacctggaagaaggacgc
atcgagatcgtggacatggcgcaaaacccaaggtaa

DBGET integrated database retrieval system