KEGG   Variovorax paradoxus B4: VAPA_1c06130
Entry
VAPA_1c06130      CDS       T02835                                 

Definition
(GenBank) putative type VI secretion system protein, Vgr family
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VAPA_1c06130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpd02044]
    VAPA_1c06130
Secretion system [BR:vpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAPA_1c06130
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: AGU47743
UniProt: T1X575
Position
1:677885..680263
AA seq 792 aa
MADHEFRIESDSPANGELMFWRIVGHEALARASSYELTVLSKNHALDAKDILGRAFDLVI
QFQDKDGGMHERHCQGHAVRFERTGHVGRHFEYRIGLRSWFWLLTKRINSRILQDKKVLE
VLDAVFEDSPIKRFKKTRASNVIGTHNPRRYCVQHQESDYQFLSRLLEDEGIYYWFDAHD
APGTMHLSDASDMAHDKLPVEGTLRHVATDTTEARHNEISRWVSARQFDTGTYASCDSDF
KAIKKKLEAAGGQPDKHELGEFEAFEFAGGYFTGGDADDKGKLRGEEIVARRQRHWALTT
WPDVAAGRSFTFEGDPDGTRDGDYVIAACIFAASHPGYESIPHATPRMPIEQALREALDD
DAVNAQARPALEALIADAPALRTDPQGTSAFLITALPVDVPFRPPRLTPRVVMPGPQSAI
VVGPDGEEIHADDFGRVKVHFHWDRYDKSDEKSTCWVRVSQPWAGKGWGGYFIPRIGQEV
IVDFLNGDPDRPIIVGRVYNDDQPIPFGSHTQSGFRTRSTPKGSASNCNEFRFEDKKGSE
QVYLHAEKNQDIEVENDETHWVGHDRTKTIDHDETTHVKHDRTETVDNNETIAVHGQRTE
TVDKDETITIHQNRTETVDLNETISIGQNRTITVGASETATVALQRTHSVGINETITVGA
AQEITVGAMQAVTVGASQTINVGANQSSSIGANRSVDVGANLSTTVGADESRSVGAGRTT
SVGKDDALTVGKNLVIDAGDSISITTGSASITMKKDGTIVIKGKDITIDASGKINAKASG
NIVMKGSKILQN
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggctgatcacgagttccgtatcgaaagcgattcgcccgccaacggcgagctgatgttc
tggcgcatcgtcggccatgaggcgctcgcgcgcgcgtcgagctacgaactcaccgtgctg
tcgaagaaccatgcgctcgacgccaaggacatcctgggccgcgccttcgacctggtcatc
cagttccaggacaaggacggcggcatgcacgagcgccactgccagggccatgcggtgcgc
ttcgagcgcacgggccacgtggggcggcacttcgaataccgcatcgggctgcgctcgtgg
ttctggctgctcaccaagcgtatcaactcgcgcatcctgcaggacaagaaggtgctcgaa
gtgctcgacgcggtgttcgaggacagcccgatcaagcgcttcaagaagaccagggcgagc
aacgtgatcggcacgcacaacccgcggcgctattgcgtgcagcaccaggagagcgactac
cagttcctgtcgcgcctgctggaagacgaaggtatctactactggttcgacgcgcacgat
gcgccgggcaccatgcatctttcggacgccagcgacatggcgcacgacaagctgccggtc
gaaggcaccctgcgccatgtggccaccgacaccaccgaggcgcgccacaacgagatctcg
cgctgggtgagcgcgcggcagttcgacaccggcacctacgcctcgtgcgacagcgacttc
aaggcgatcaagaagaaactcgaggccgcgggcggccagcccgacaagcacgagctgggc
gaattcgaagccttcgaatttgccggcggctacttcacgggcggggatgcggacgacaag
ggcaagctgcgcggcgaggagatcgtcgcgcgccgccagcgccactgggcgctcaccacc
tggcccgacgtggcggcgggacgcagcttcaccttcgagggggaccccgacggcacgcgg
gatggcgactacgtgatcgcggcctgcatcttcgcggcgagccaccccggctacgagagc
attccccatgccacgccgaggatgcccatcgagcaggcgctgcgcgaggcgctcgacgac
gacgccgtgaacgcccaggcgcggcccgcgctcgaggcactgatcgccgacgcacccgcg
ctgcgcaccgacccgcagggcaccagcgccttcctgatcaccgcgctgccggtcgacgtg
ccgttccgtccgccgcggctcacaccgcgcgtggtgatgccagggccgcagtcggccatc
gtggtggggccggacggcgaagagatccacgccgacgacttcggccgcgtgaaggtgcac
ttccactgggaccgctacgacaagagcgacgagaagtcgacctgctgggtgcgcgtgtcg
cagccgtgggcaggcaagggctggggcgggtacttcattccgcgcatcgggcaggaggtg
atcgtcgacttcctgaacggcgaccccgaccggccgatcatcgtgggccgcgtctacaac
gacgatcagccgatcccgttcggctcgcacacgcagagcggctttcgcacgcgctccacg
cccaagggcagcgcctcgaactgcaacgagttccgcttcgaggacaagaaggggtcggag
caggtgtacctgcacgccgagaagaaccaggacatcgaggtcgaaaacgacgagacccat
tgggtgggccacgaccgcaccaagaccatcgaccacgacgagaccacgcacgtcaagcac
gaccgcaccgagacggtggacaacaacgagaccatcgccgtgcacggccagcgcaccgag
acggtggacaaggacgagaccatcacgatccaccagaaccgcacggagacggtggacctg
aacgagacgatctccatcggccagaaccgcacgatcacggtgggcgcgagcgagacggcg
accgtggcgctgcagcgcacgcattcggtggggatcaacgagaccatcaccgtcggcgca
gcgcaggagatcacggtgggggcgatgcaggcggtgacggtgggggcgagccagacgatc
aatgtgggggcgaaccagtcgagcagcatcggggcgaaccggtcggtggatgtgggggcg
aatctgtcgaccaccgtgggcgccgatgaatcgcgcagcgtgggcgcgggccgcacgacc
agcgtggggaaggacgatgcgctcaccgtcggcaagaacctcgtgatcgacgcgggcgac
tccatctcgatcaccaccggcagcgcgagcatcacgatgaagaaggacgggaccatcgtc
atcaagggcaaggacatcacgatcgacgcctccgggaagatcaacgcgaaggcgagcggc
aatatcgtgatgaagggctcgaagattctgcagaactga

DBGET integrated database retrieval system