KEGG   Variovorax paradoxus B4: VAPA_1c08280Help
Entry
VAPA_1c08280      CDS       T02835                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00051  Fructose and mannose metabolism
vpd00520  Amino sugar and nucleotide sugar metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VAPA_1c08280
   00520 Amino sugar and nucleotide sugar metabolism
    VAPA_1c08280
Enzymes [BR:vpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VAPA_1c08280
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     VAPA_1c08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGU47948
UniProt: T1X5T9
Position
1:complement(912012..913430)
Genome map
AA seq 472 aa AA seqDB search
MHVLSVVLSGGAGSRLWPASRQAFPKPFMKLGGSTLLQQAIERGQACGTGDLMIVTNKDH
LFLTKDVLDQMADPPDATLLLEPKGRNTGPAIALAALQCIEQFGGDTVMLVLSADHLVPD
VEAFVASASQAFKLATQGALVVFGISPTSPDTGFGYIEVAQVSRSSQPAKRFVEKPDLQT
AQEYLATGRYYWNSGMFCFTADAIVAAFEKYAPELLVAARKALRTSEHEGNMIQFDLHAF
GLQPDISIDYAVMEPADNVHVVPAKFHWSDVGSWPAVAKAQPPDASGNTMPSDVVAIDTT
DTHVQVDSHIPKLVATLGVHNLVIVDTPDALLVAHKDSAQEVKKVVDTLKARKHEAVHLP
SVVHRPWGTYATLKEEDDYKVKRITVKPGESLSLQYHHQRSEHWVVVQGRGIVQIGDAEH
VTKPGEYRYIPLKEKHRLTNIGEELLVLIEVQCGVYLGEDDIVRLADTYGRT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttctatcagttgtgctctcagggggagcgggttcccggctctggccggcatcg
cggcaagcatttcccaaacctttcatgaagctcggcggttcgacgctgctgcagcaggcc
atcgaacgcggccaagcctgtggaactggcgatctgatgatcgttaccaacaaggatcat
ctgttcctcaccaaggacgtgttggaccagatggccgatccgcccgatgccaccctgctg
ctcgagcccaagggccgtaataccggcccggccattgcgctcgcggcgctgcaatgtatc
gagcaattcggcggcgacaccgtgatgctcgtgctgtctgccgaccaccttgtgcccgat
gtcgaggccttcgtcgcgagtgccagccaggccttcaagctcgccacgcagggcgcgctg
gtggtcttcggcatcagcccgacgagtcccgacaccggcttcggctatatcgaagtggcc
caggtctcgcgctcgagccaaccagccaagcgcttcgtcgagaagcctgatctgcagacc
gcgcaggaatatctggcaacaggacgctactactggaacagcggcatgttctgctttaca
gcagacgcaattgtggccgccttcgagaagtacgcgccggaactgctggtcgccgccaga
aaggcactgcggacatcggaacacgagggaaacatgatccagttcgacctgcatgccttc
ggactccagcccgacatcagcatcgactatgcagtgatggaacctgccgacaacgtgcac
gtcgtgccggccaagttccattggagcgacgttggctcctggcctgcggtcgcaaaagcc
cagccgcccgatgcgagcggcaacacgatgccatcggacgtcgtggcgatcgacaccacc
gacacccatgtgcaggtcgacagccacatcccgaagctggtggcgacgctgggtgttcac
aacctcgtcatcgtcgacactcccgacgcgcttctcgttgcccacaaagacagcgcacag
gaagtcaaaaaggtcgtcgacacactgaaggcgcgaaagcatgaggcggttcacctgccc
tccgtagtgcaccgcccatggggcacctatgcaaccctgaaagaagaggacgattacaaa
gtcaagcggatcacggtcaaacccggagaatcgctgtctttgcaatatcaccaccagcga
tccgaacattgggtcgtggtgcaagggcgaggcatcgtccagatcggcgacgccgaacat
gtcacgaaaccgggcgagtatcgctacatcccattgaaggagaaacatcgtttgaccaac
atcggcgaagaactattggtgctcatcgaagtccagtgcggtgtgtatcttggagaggac
gacatcgtccgactcgcagacacctacggacgcacatga

DBGET integrated database retrieval system