KEGG   Variovorax paradoxus B4: VAPA_1c08280
Entry
VAPA_1c08280      CDS       T02835                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00051  Fructose and mannose metabolism
vpd00520  Amino sugar and nucleotide sugar metabolism
vpd00541  O-Antigen nucleotide sugar biosynthesis
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VAPA_1c08280
   00520 Amino sugar and nucleotide sugar metabolism
    VAPA_1c08280
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    VAPA_1c08280
Enzymes [BR:vpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VAPA_1c08280
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     VAPA_1c08280
SSDB
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Other DBs
NCBI-ProteinID: AGU47948
UniProt: T1X5T9
Position
1:complement(912012..913430)
AA seq 472 aa
MHVLSVVLSGGAGSRLWPASRQAFPKPFMKLGGSTLLQQAIERGQACGTGDLMIVTNKDH
LFLTKDVLDQMADPPDATLLLEPKGRNTGPAIALAALQCIEQFGGDTVMLVLSADHLVPD
VEAFVASASQAFKLATQGALVVFGISPTSPDTGFGYIEVAQVSRSSQPAKRFVEKPDLQT
AQEYLATGRYYWNSGMFCFTADAIVAAFEKYAPELLVAARKALRTSEHEGNMIQFDLHAF
GLQPDISIDYAVMEPADNVHVVPAKFHWSDVGSWPAVAKAQPPDASGNTMPSDVVAIDTT
DTHVQVDSHIPKLVATLGVHNLVIVDTPDALLVAHKDSAQEVKKVVDTLKARKHEAVHLP
SVVHRPWGTYATLKEEDDYKVKRITVKPGESLSLQYHHQRSEHWVVVQGRGIVQIGDAEH
VTKPGEYRYIPLKEKHRLTNIGEELLVLIEVQCGVYLGEDDIVRLADTYGRT
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcacgttctatcagttgtgctctcagggggagcgggttcccggctctggccggcatcg
cggcaagcatttcccaaacctttcatgaagctcggcggttcgacgctgctgcagcaggcc
atcgaacgcggccaagcctgtggaactggcgatctgatgatcgttaccaacaaggatcat
ctgttcctcaccaaggacgtgttggaccagatggccgatccgcccgatgccaccctgctg
ctcgagcccaagggccgtaataccggcccggccattgcgctcgcggcgctgcaatgtatc
gagcaattcggcggcgacaccgtgatgctcgtgctgtctgccgaccaccttgtgcccgat
gtcgaggccttcgtcgcgagtgccagccaggccttcaagctcgccacgcagggcgcgctg
gtggtcttcggcatcagcccgacgagtcccgacaccggcttcggctatatcgaagtggcc
caggtctcgcgctcgagccaaccagccaagcgcttcgtcgagaagcctgatctgcagacc
gcgcaggaatatctggcaacaggacgctactactggaacagcggcatgttctgctttaca
gcagacgcaattgtggccgccttcgagaagtacgcgccggaactgctggtcgccgccaga
aaggcactgcggacatcggaacacgagggaaacatgatccagttcgacctgcatgccttc
ggactccagcccgacatcagcatcgactatgcagtgatggaacctgccgacaacgtgcac
gtcgtgccggccaagttccattggagcgacgttggctcctggcctgcggtcgcaaaagcc
cagccgcccgatgcgagcggcaacacgatgccatcggacgtcgtggcgatcgacaccacc
gacacccatgtgcaggtcgacagccacatcccgaagctggtggcgacgctgggtgttcac
aacctcgtcatcgtcgacactcccgacgcgcttctcgttgcccacaaagacagcgcacag
gaagtcaaaaaggtcgtcgacacactgaaggcgcgaaagcatgaggcggttcacctgccc
tccgtagtgcaccgcccatggggcacctatgcaaccctgaaagaagaggacgattacaaa
gtcaagcggatcacggtcaaacccggagaatcgctgtctttgcaatatcaccaccagcga
tccgaacattgggtcgtggtgcaagggcgaggcatcgtccagatcggcgacgccgaacat
gtcacgaaaccgggcgagtatcgctacatcccattgaaggagaaacatcgtttgaccaac
atcggcgaagaactattggtgctcatcgaagtccagtgcggtgtgtatcttggagaggac
gacatcgtccgactcgcagacacctacggacgcacatga

DBGET integrated database retrieval system