KEGG   Variovorax paradoxus B4: VAPA_1c16650Help
Entry
VAPA_1c16650      CDS       T02835                                 

Definition
(GenBank) putative farnesyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00900  Terpenoid backbone biosynthesis
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAPA_1c16650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:vpd01006]
    VAPA_1c16650
Enzymes [BR:vpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     VAPA_1c16650
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     VAPA_1c16650
Prenyltransferases [BR:vpd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   VAPA_1c16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGU48774
UniProt: T1X8W6
Position
1:1799538..1800455
Genome map
AA seq 305 aa AA seqDB search
MSAVKAVEWDAARLASWSDPYLARVEAALSRWVGVDAPVLLGDAMRYAVLDGGKRLRPLL
VLAASEAVGGNAAAALRAACATELIHAYSLVHDDLPSMDNDVLRRGKPTVHVKFGEADAL
LAGDALQALAFELLTPDGDEIPASIQAMLCRLLARAAGSQGMAGGQAIDLASVGLALNEA
QLREMHRLKTGALLQGSVEMGAACAGAVASDALAALRDYGAAIGLAFQVVDDILDVTADS
QTLGKTAGKDAAADKPTYVSLWGLDGARAQARQLLAESLAALDRSGLADTAALRALAHMV
VDRDR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggttaaagcggtggaatgggatgctgcacgcctggccagctggagcgacccg
tacctggcgcgcgtcgaggcggcgctttcgcgctgggtcggcgtcgatgcgccggtgctg
ctcggcgatgccatgcgctatgccgtgctggacggcggcaagcggctgcggccgctcctg
gtgctggccgcgagcgaagcggtcggcggcaatgcggctgcggcgctgcgcgcggcctgt
gcaacggaactgatccacgcctactcgctggtgcacgacgacctgccgagcatggacaac
gacgtgctgcggcgtggcaagcccacggtgcacgtgaagttcggcgaagccgatgcgctg
ctggccggcgatgccttgcaggccctggccttcgagctgctgacgcccgacggcgacgag
attcccgcatcgatccaggccatgctgtgccggttgctcgcgcgtgccgcgggcagccag
ggcatggcgggcgggcaggccatcgacctggccagtgtgggcctggcgctgaacgaagcg
cagctgcgcgaaatgcaccgcctgaaaaccggcgcgctgctgcagggcagcgtcgagatg
ggcgcggcctgtgccggtgccgtggcatccgatgcgctggccgccctgcgcgactacggc
gccgccatcggcctggcgttccaggtggtcgacgacattctcgacgtcacggccgattcg
cagaccctcggcaagacggccggcaaggatgcggccgccgacaagcccacctatgtttcg
ctgtggggcctcgacggcgcgcgtgcgcaggcgaggcagctgctggccgaatcgcttgcg
gcgctggaccgcagcggccttgccgataccgcggccttgcgcgcgctggcccacatggtc
gtcgaccgcgaccgatga

DBGET integrated database retrieval system