KEGG   Variovorax paradoxus B4: VAPA_1c22850Help
Entry
VAPA_1c22850      CDS       T02835                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00360  Phenylalanine metabolism
vpd00362  Benzoate degradation
vpd00620  Pyruvate metabolism
vpd00621  Dioxin degradation
vpd00622  Xylene degradation
vpd00650  Butanoate metabolism
vpd01100  Metabolic pathways
vpd01120  Microbial metabolism in diverse environments
vpd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAPA_1c22850
   00650 Butanoate metabolism
    VAPA_1c22850
  Amino acid metabolism
   00360 Phenylalanine metabolism
    VAPA_1c22850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAPA_1c22850
   00622 Xylene degradation
    VAPA_1c22850
   00621 Dioxin degradation
    VAPA_1c22850
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VAPA_1c22850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGU49389
UniProt: T1XAM9
Position
1:2424978..2425919
Genome map
AA seq 313 aa AA seqDB search
MAERKLKAAILGSGNIGTDLMIKILRHGRHVEMGAMVGIDATSDGLARAARMGVATTHEG
VDGLARLPVFEEVDIVFDATSASAHAMHDAFLRKHKPNIRCVDLTPAAIGPYCIPVVNGT
EHLDAINVNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
AKAIEVVGGARKGKAIIVLNPADPPLIMRDTVYTLSEAADERQIAASVEETVAAVNRYVP
GYRLKQQVQFDRVENLKVPGVGCISGLKTTIFLEVEGAAHYLPAYAGNLDIMTSAALATA
ERMAERILEGATA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgtaaactcaaagccgccatcctgggcagcgggaacatcggcacggacttg
atgatcaagattctgcgccacggccggcacgtcgagatgggtgcgatggtggggatcgac
gccacttccgatggtctcgcccgcgcagcgcgaatgggtgtcgccaccacgcacgaaggt
gtcgacgggcttgcgcggcttccggtattcgaagaagtcgacatcgtgttcgatgccaca
tccgcctcggcccatgccatgcacgacgcattcctgcgcaagcacaagccgaacattcgc
tgtgtcgacctgacgccggccgccatcgggccttactgcattcccgtcgtgaacggcacg
gaacacctggatgcgataaacgtcaacatggtgacctgcggcggccaggcaacgatcccg
atcgtcgccgcggtcagcagggttgccaaggtccactatgcggagatcgtcgcctcgatc
tccagcaagagtgcgggcccaggcacgcgcgccaacatcgacgagttcactgaaaccacg
gccaaggccattgaagtggtcggcggcgctcgcaagggcaaggcgatcatcgtcctcaat
cctgccgacccgccgctgatcatgcgcgatacggtctacacgctgagcgaagccgcggac
gagcgccagattgccgcgagcgtggaagaaaccgtggctgcggtgaatcgctacgtgccg
gggtatcgcctgaagcaacaagtgcagttcgatcgcgtggagaacctcaaggtgcccggc
gttggttgcatctccggcctgaagaccactatttttctcgaggtcgagggtgccgcccac
tacctccccgcctatgcgggcaacctggacatcatgaccagcgccgcgcttgccacggcg
gagcgcatggccgaacgcatcctggaaggggcgacagcatga

DBGET integrated database retrieval system