KEGG   Variovorax paradoxus B4: VAPA_1c22860Help
Entry
VAPA_1c22860      CDS       T02835                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00360  Phenylalanine metabolism
vpd00362  Benzoate degradation
vpd00621  Dioxin degradation
vpd00622  Xylene degradation
vpd01100  Metabolic pathways
vpd01120  Microbial metabolism in diverse environments
vpd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    VAPA_1c22860
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAPA_1c22860
   00622 Xylene degradation
    VAPA_1c22860
   00621 Dioxin degradation
    VAPA_1c22860
Enzymes [BR:vpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     VAPA_1c22860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AGU49390
UniProt: T1XB38
Position
1:2425916..2426971
Genome map
AA seq 351 aa AA seqDB search
MKKIYISDVTLRDGSHAVRHQYSVEQARQIAQALDEAGVDSIEVAHGDGLQGGSFNYGFG
AHTDVEWIEAVASVVKRAKVATLLLPGIGTVHDLKAAYDAGARVVRIATHCTEADVSRQH
IECARKLGMDTVGFLMMSHMTAPAQFAQQAKLMEGYGATCVYVVDSGGALNMNDVRDRFR
ALKDVLDSATLTGIHAHHNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFIAA
ASRMGWLHGADLYKLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHAEAAARKY
GLKTVDILVELGHRRMVGGQEDMIVDVALDLLRKRGESSPVAESSAAFASS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatctacatctcggacgtgacgctgcgcgacggcagccatgccgtgcgccat
cagtacagcgtcgagcaggcgcgccagatcgcacaggcgctggacgaggccggcgtggac
tcgatcgaggtcgcgcacggtgatgggctgcagggcggcagtttcaactacggcttcggc
gcccacaccgatgtcgagtggatcgaagcggtcgccagcgtcgtgaaacgggcaaaggtt
gcgaccctgctgctgccaggcattggcaccgtccatgatctcaaggctgcctacgatgct
ggcgccagagttgtgcgtatcgcgacgcactgcaccgaggccgacgtcagccggcaacac
atcgagtgtgcgcgaaagctgggcatggacacggtcggctttctcatgatgagccacatg
accgcacccgcgcagtttgcgcagcaagccaagctcatggaaggctacggcgcaacctgc
gtctatgttgtcgattccggcggcgctttgaacatgaacgacgttcgcgaccgcttccgt
gcactcaaagacgtcttggactctgcaacactcaccggaatccacgcacaccacaacctg
agcctcggcgtggccaactccatcgtcgcggtggaagaggggtgcgaccgcgtggacgcc
agtctggcgggcatgggcgcaggggcgggcaatgccccgctcgaagtgttcatcgctgca
gcaagtcgcatgggctggctccatggcgccgacctgtacaagttgatggacgccgctgac
gacatcgttcggcccctgcaggaccggcccgtccgggtcgaccgtgagaccctcgccctg
ggctatgccggtgtgtattcgagtttcctgcgccacgccgaagcggcggcccgaaagtac
ggattgaaaacagtcgacatcctcgtggaacttgggcatcgccggatggtgggcggtcag
gaggacatgattgttgatgttgccctcgatctcttgcgcaagcgtggtgaaagttctccg
gtcgccgagagttccgctgcattcgctagttcgtga

DBGET integrated database retrieval system