KEGG   Variovorax paradoxus B4: VAPA_1c23630Help
Entry
VAPA_1c23630      CDS       T02835                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase Ndk
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00230  Purine metabolism
vpd00240  Pyrimidine metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
Module
vpd_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
vpd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
vpd_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VAPA_1c23630 (ndk)
   00240 Pyrimidine metabolism
    VAPA_1c23630 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vpd04131]
    VAPA_1c23630 (ndk)
Enzymes [BR:vpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     VAPA_1c23630 (ndk)
Membrane trafficking [BR:vpd04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    VAPA_1c23630 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGU49465
UniProt: T1XBB4
Position
1:2525079..2525504
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGKIVSRFEAAGLKIVAAKLVHLSRNEAEQFYAVHKERPFF
KDLVDFMISGPVFVQVLEGENAIAKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSD
APETAANEVAFFFAGLNVYAR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaacgtaccctttccatcatcaagcccgacgccgtcgccaagaacgtcatc
ggcaagatcgtttcccgcttcgaagctgccggcctcaagatcgttgccgccaagctggtg
catctgtcgcgcaacgaagccgagcagttctacgcggtccacaaggaacgtccgttcttc
aaggacctggtcgatttcatgatctccggccccgtgttcgtgcaagtgctcgaaggcgag
aacgccatcgccaagaaccgcgacctgatgggtgccacggaccccaagaaggcggccccc
ggcaccatccgcgccgacttcgccgacagcatcgacgccaacgccgtgcacggttcggac
gctcccgaaaccgccgccaacgaagtggcgttcttcttcgccggcctcaacgtctacgcg
cgctga

DBGET integrated database retrieval system