KEGG   Variovorax paradoxus B4: VAPA_1c27870Help
Entry
VAPA_1c27870      CDS       T02835                                 

Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00220  Arginine biosynthesis
vpd00330  Arginine and proline metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
vpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    VAPA_1c27870
   00330 Arginine and proline metabolism
    VAPA_1c27870
Enzymes [BR:vpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     VAPA_1c27870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGU49884
UniProt: T1XC27
Position
1:2952643..2953539
Genome map
AA seq 298 aa AA seqDB search
MPTRRYAILEAPSTLGLATEGVEHLPDRLLELGLADRIHARRAGPMAVPPKDPKPDPATL
VLNAGAIASWSPMLADAVEKVLDGDEFPIVLGGDCTIVLGSMLALRRRGRYGLFFIDGNA
DFFQPEAEPNSEGASMDLALVTGHGPALLTDLEGRRPLVRPEDTVAFAFRDHEDQAQFGS
QPLPAELMACDLPTIRRLGVEAATRAAIDHLTRAELDGFFIHLDADCLDDAIMPAVDFRV
PGGLSWDELSTALRLILASEKAVGLEVTIYNPRLDEDGSAGSGLAAVLAAGLGTAAPA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccgacgctatgccattcttgaagcgccctccacgctcggcctggcgaccgag
ggcgtggagcacctgcccgaccggctgctggaactcggactcgcagaccgcatccatgcg
cgccgtgccgggccaatggccgttccgccgaaagacccgaagcccgatccagccaccctg
gtgctgaatgccggcgcgatcgcgtcgtggtcgcccatgctcgccgatgccgtggagaag
gtactggatggggacgaattcccgatagtgctgggcggcgactgcacgatcgtgctgggc
tcgatgctcgcgctgcgccggcgcggccgctacggcctgttcttcatcgacggcaatgcc
gatttcttccagcccgaagccgagcccaacagcgaaggcgcgtccatggacctagccctt
gtcaccggccacgggccggcactgctgaccgacctggagggccgccgtccgctggtgcgg
cccgaggacaccgtcgccttcgcattccgcgaccacgaagaccaggcccaattcggcagc
cagcctttgccggcagagctcatggcctgcgatctccccaccatccgccgcctgggcgtc
gaagccgcaactcgtgcggccattgaccacctgacgcgggccgagctcgacggcttcttc
atccatctggacgccgattgcctcgacgatgccatcatgccggcagtcgatttccgcgta
ccaggagggctgtcatgggacgaactgtcgacggcgctccggctcatcctggcgagcgaa
aaggcggtcggcctcgaggtcaccatctacaacccgcgcctcgacgaggatggcagcgcc
ggcagcggccttgctgcggtgctggccgcagggctgggcactgccgctcctgcttga

DBGET integrated database retrieval system