KEGG   Variovorax paradoxus B4: VAPA_1c32160Help
Entry
VAPA_1c32160      CDS       T02835                                 

Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00562  Inositol phosphate metabolism
vpd00564  Glycerophospholipid metabolism
vpd00565  Ether lipid metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    VAPA_1c32160
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VAPA_1c32160
   00565 Ether lipid metabolism
    VAPA_1c32160
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VAPA_1c32160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vpd02042]
    VAPA_1c32160
Enzymes [BR:vpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     VAPA_1c32160
Bacterial toxins [BR:vpd02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   VAPA_1c32160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AGU50303
UniProt: T1XCL5
Position
1:complement(3392247..3394499)
Genome map
AA seq 750 aa AA seqDB search
MNTTNRRDFFRKSAGAIGAASAMTMLPPVIRKALAVEAAVDTGTIQDIKHIVILMQENRS
FDHYFGTLRGVRGFGDRFPIPLASGKPVYFQPNPSGGAEIQPFRRDSRIANALIGSGTPH
NFPDQQAAWNQGKMDRWIQFKNQATMGYYLRDDIPFQFALADAFTICDGYHCSILTGTDP
NRIIFWSGSNFNPELRKKGINSTDTDSEPVNSRCWPSPSSWVAGRGQEADGTGQKDPTTG
AYNYKYVNNAFKWNTLPDVLQKAGISWHIYQNMNNNWTGAMHGCLAFESFRTAQPGSPIY
EHGLTGGPATADGAVNFLAQLKQDVMNGTLPQVSWVLPTQALAEHPGSSEGVAGAADFIS
DVLSALTSNPAVWSKTALFVTFDENDGFFDHLAMPAVPSYDANGELMGKSTVPLDGEYFD
ASVGSYLNAADTTSGKIRPWGLSSRVPTYVVSPWSKGGWVNSQVFDHTSVGRFLEKRFGI
TVDAISPWHRAVCGDLTSCFDFVSPNDPVVPKLPDTSNYPAINAAQRALANTAAVTKAPA
TPQPLYQETGTRFSRALPYELHTSARIEPRGLVSLIFGNTGEQGAVFHVYDKLHLDRIPR
RYTVEAGKQIADYWNTGATDSGKYDLWVYSTNGYVRSFQGDALATDTAAFKPEVQVCYDP
AAGQVYVKVHNAGTGSGTVAVTANAYRADGPWSLDVAAGATGMLHWSLEDSGHWYDFTVT
ADNFERRFAGRVETGKPSVSDPAMALHLKA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccaaccgtcgcgatttcttccgcaagtcggcgggcgccatcggcgccgca
tcggccatgacgatgcttccgcccgtgatccgcaaggcgctcgccgtcgaggccgctgtc
gacaccggcaccatccaggacatcaagcacatcgtgatcctgatgcaggagaaccgcagc
ttcgaccactacttcggcaccctgcgcggcgtgcgcggcttcggcgaccgcttcccgatt
ccgctggccagcggcaagccggtgtatttccagcccaatcccagcggcggcgcggagatc
cagcccttccgccgcgattccaggatcgcaaatgcgctgatcggatccggcacgccgcac
aacttccctgaccagcaagcggcatggaaccagggaaagatggatcgctggattcagttc
aagaaccaggcgacgatgggctactacctgcgcgacgacattccgttccagttcgcgctg
gccgatgcattcacgatctgcgacggctaccactgttccatcctcaccggcaccgacccg
aaccgcatcattttctggtcgggttccaacttcaacccggagctgcgcaagaagggcatc
aacagcacggacaccgattccgaacccgtcaactcgcgctgctggcccagcccgtcgagc
tgggttgcgggtcgggggcaggaggccgacggcaccggtcagaaagaccccaccaccggg
gcctacaactacaagtacgtcaacaacgccttcaaatggaacacgttgccggacgtactg
cagaaggcaggcatcagctggcacatctaccagaacatgaacaacaactggacgggcgcc
atgcacggctgcctggccttcgagagcttccgcaccgcgcagccgggttcgccgatctat
gaacacggcctgacgggtggccccgcgacggcggacggcgctgtcaatttcctcgcccag
ctcaagcaggacgtgatgaacggcaccctgccgcaggtctcgtgggtgctgcccacgcag
gctctggccgagcatcccggcagcagcgaaggcgttgccggcgccgccgacttcatctcg
gatgtgctgagcgcgctgacgtccaaccccgcggtctggagcaagacggcgctcttcgtg
accttcgacgagaacgacggcttcttcgaccatctggcgatgccggcggtgccgtcgtac
gacgccaatggcgagctgatgggcaagtccaccgtgccgctggatggcgagtatttcgac
gcctccgtgggcagctacctgaacgccgccgacaccaccagcggcaagattcgcccatgg
ggcctgagttcgcgcgtgccgacgtacgtggtgtcgccgtggagcaagggcggctgggtc
aattcgcaagtgttcgaccacacctcggtgggccggttcctggagaagcgtttcggcatc
acggtggacgccatcagcccgtggcatcgcgcggtctgcggcgacctcacctcctgcttc
gacttcgtcagcccgaacgatccggtggtccccaagctgcccgacacgagcaactatccc
gcgatcaatgcagcgcagcgagctctggccaacacggctgccgtgacaaaggcgcccgcc
acgccgcagccgctgtaccaggagaccggcacgcgcttttcgcgcgcgctgccctacgag
ctgcacaccagcgcgcgcatcgagccgcgcggcttggtgtcgctgatcttcggcaacacc
ggcgagcagggcgcggtgttccacgtctacgacaagctgcacctggaccgcattccgcgc
cgctacacggtggaggccggcaagcagattgccgactactggaacaccggcgccaccgac
agcggcaagtacgacctgtgggtctacagcaccaatggctacgtgcgcagcttccagggc
gatgcgctggcgaccgacaccgcggccttcaagcccgaggtgcaggtgtgctacgacccg
gccgcgggccaggtctacgtgaaggtgcacaacgccggcacgggcagcggcacggtcgcg
gtcacggccaacgcctaccgcgccgacggcccctggtcgctcgacgtggctgcgggagcc
acgggcatgctgcactggagcctggaagacagcggccactggtacgacttcaccgtgacc
gccgacaacttcgagcgccgcttcgcgggccgcgtcgagaccggcaagccgagcgtgagc
gatccggcgatggcgctgcacctgaaggcctga

DBGET integrated database retrieval system