KEGG   Variovorax paradoxus B4: VAPA_1c53880Help
Entry
VAPA_1c53880      CDS       T02835                                 

Definition
(GenBank) putative acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00520  Amino sugar and nucleotide sugar metabolism
vpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VAPA_1c53880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpd01005]
    VAPA_1c53880
Enzymes [BR:vpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     VAPA_1c53880
Lipopolysaccharide biosynthesis proteins [BR:vpd01005]
 Unusual sugar
  VAPA_1c53880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 BacteriocIIc_cy
Motif
Other DBs
NCBI-ProteinID: AGU52440
UniProt: T1XJX8
Position
1:complement(5666764..5667339)
Genome map
AA seq 191 aa AA seqDB search
MNLIHATAIVDAGAQIGTGTRVWHWVHISASAVIGDDCSLGQSVYVGNDVHIGRNVKIQN
NVSVYDGVTLEDEVFCGPSMVFTNVYNPRSGVSRKSEYRKTLVRRGATLGANCTIVCGVT
IGCYAFIGAGAVVNRNVPDFALMLGVPARPAGWMSRHGERLKFVGSTATCATTGEKYMLR
EGLCVLVEASQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttgatccatgcgacggccatcgtcgacgctggagcgcaaatcgggacggggacc
cgcgtctggcattgggtgcacatcagtgcaagtgcagtaatcggagatgattgttcgctg
ggacagagcgtctatgtaggcaacgatgtacatattggccgcaacgtcaagatccagaac
aacgtcagcgtatatgacggagtgaccctggaagacgaggtgttctgcggtccgagtatg
gtgttcacgaacgtctacaaccctcgttcaggagtgagtcgcaagagcgaatatcgaaag
acgctggtgcgacgaggtgcgacgctcggagcgaactgcaccattgtctgtggggtgact
atcggctgctatgcattcatcggtgctggcgctgtcgtgaaccgcaacgtgcctgacttt
gcgttgatgctcggcgtgcctgcgcggccagcagggtggatgagtcgtcacggtgagcga
ttgaaattcgtcggtagcactgcaacctgcgccactaccggggagaaatacatgttacgt
gagggcttgtgcgtactggtcgaggcttcacaatga

DBGET integrated database retrieval system