KEGG   Variovorax paradoxus B4: VAPA_2c06570Help
Entry
VAPA_2c06570      CDS       T02835                                 

Definition
(GenBank) thiolase domain-containing protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00071  Fatty acid degradation
vpd00072  Synthesis and degradation of ketone bodies
vpd00280  Valine, leucine and isoleucine degradation
vpd00310  Lysine degradation
vpd00362  Benzoate degradation
vpd00380  Tryptophan metabolism
vpd00620  Pyruvate metabolism
vpd00630  Glyoxylate and dicarboxylate metabolism
vpd00640  Propanoate metabolism
vpd00650  Butanoate metabolism
vpd00900  Terpenoid backbone biosynthesis
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01120  Microbial metabolism in diverse environments
vpd01130  Biosynthesis of antibiotics
vpd01200  Carbon metabolism
vpd01212  Fatty acid metabolism
vpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAPA_2c06570
   00630 Glyoxylate and dicarboxylate metabolism
    VAPA_2c06570
   00640 Propanoate metabolism
    VAPA_2c06570
   00650 Butanoate metabolism
    VAPA_2c06570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VAPA_2c06570
   00072 Synthesis and degradation of ketone bodies
    VAPA_2c06570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAPA_2c06570
   00310 Lysine degradation
    VAPA_2c06570
   00380 Tryptophan metabolism
    VAPA_2c06570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAPA_2c06570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAPA_2c06570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VAPA_2c06570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpd04147]
    VAPA_2c06570
Enzymes [BR:vpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VAPA_2c06570
Exosome [BR:vpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAPA_2c06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C UPF0565
Motif
Other DBs
NCBI-ProteinID: AGU53215
UniProt: T1XM68
Position
2:complement(676780..676953)
Genome map
AA seq 57 aa AA seqDB search
MSIPVQKHRVVIVDGGASGCRVLVTLLHEMRRRSADKGLASLCIGGGMGVALAVERA
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatccccgtgcagaagcaccgcgtcgtcatcgtggacggcggggcctcgggctgc
cgcgtgctggtgacgctgctgcacgagatgcgtcgccgtagcgccgacaagggcctggcc
tcgctgtgcatcggcggcggcatgggcgtggcgctcgcggtcgaacgcgcttga

DBGET integrated database retrieval system