KEGG   Variovorax paradoxus B4: VAPA_2c09250Help
Entry
VAPA_2c09250      CDS       T02835                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00430  Taurine and hypotaurine metabolism
vpd00460  Cyanoamino acid metabolism
vpd00480  Glutathione metabolism
vpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    VAPA_2c09250
   00460 Cyanoamino acid metabolism
    VAPA_2c09250
   00480 Glutathione metabolism
    VAPA_2c09250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vpd01002]
    VAPA_2c09250
Enzymes [BR:vpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     VAPA_2c09250
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     VAPA_2c09250
Peptidases and inhibitors [BR:vpd01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   VAPA_2c09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AGU53481
UniProt: T1XLQ9
Position
2:945539..947170
Genome map
AA seq 543 aa AA seqDB search
MKKEAMVVCPQPEAAESGIDILRAGGNAVDAAVATALAQTVVDPLMCGIAGFGTAAVYLP
GAQVHEYFDFHSPAPLAAREDMWEHLLEGETKDGFGFILKGRVNDIGPQSIGTPATLKGL
EAMHQAHGRLPWQQVVEPAIRWAAEGYFVRPGMHAFWIDEPTMGRVGNLERLQYCEDSRQ
LYCRPDGRPKPIGAPLRNEGMAAVLRQIAEEGARPFYQGDLAQKMVAHLQSLGALITRDD
LARYQVQRNPPLVGRYRDRTITTNRPPGGGAMLLEMLNILEHFDLASLEHNGPAYLQKVC
EAMKKATIDKDRCIGDPKFFDVPLDQLLSKDMAREVAEQIHTGHRFNVERVNPGAPVPRD
TTHLSVVDADGNAVSLTHSLAMPSGIITPGMGFLYNGCMGVFDPRPGRAGSIQPGKSRFT
SSCPTMTFKDGELDVVLGAPGGTQIAMGVLQVLLNVIDHGMEVQAAVSAPRFSSTSNSID
VCNRIPRSVTRTLEAQGYAIGRNPYNYTIGWVHGVQVQADGLHGGADPGRDGVAYRLRMD
PAR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaagcaatggtggtctgcccgcagccggaggccgccgaatccggcattgac
atcctgcgcgcaggcggcaacgcggtggatgccgccgtggccactgccttggcccagacg
gtggtcgacccgctgatgtgcggcatcgcaggttttggcaccgccgccgtgtacctgccc
ggcgcccaggtgcatgaatatttcgacttccactcgcccgcgccgctggcggccagggaa
gacatgtgggagcacctgttggagggcgagaccaaagacggctttggtttcatcctcaag
ggccgggtcaacgacatcggcccccagtccatcggcacgccggccaccctcaagggcctg
gaggccatgcaccaggcgcatggccgcttgccgtggcagcaggtggtggaacccgccatc
cgatgggcggcggagggctactttgtgcgacccggcatgcacgccttctggatcgacgag
cccaccatgggccgcgtcggcaacttggagcgactgcagtactgcgaggacagccgccag
ctgtactgccgccccgacggccgccccaagcccatcggtgcgccgctgcgcaacgaaggc
atggccgccgtgctgcgccagattgccgaggaaggcgcgcgcccgttctaccagggcgac
ctggcgcaaaaaatggtggcgcacctgcagtcgctgggcgcgctgatcacgcgcgacgat
ctggcccgctaccaagtgcagcgcaacccgccgctggtgggccgctaccgcgaccgcacc
atcacgaccaaccgacctccgggcggcggcgccatgctgctggagatgctcaacatcctc
gagcacttcgatctggcgagcctggagcacaacggccccgcctacctgcagaaggtgtgc
gaggccatgaaaaaggccacgatcgacaaggaccgctgcatcggcgacccgaagttcttc
gacgtgccgttggatcagttgctgtccaaggacatggcccgcgaagtggccgagcagatc
cacacgggtcatcgcttcaacgtggagcgcgtgaaccccggtgcgcccgtgccgcgcgac
accacccacctgagcgtggtggacgctgacggcaacgccgtgtccctcactcactcgctc
gccatgccctcgggcatcatcaccccgggcatgggcttcctctacaacggctgcatgggc
gtgttcgacccgcgcccgggccgcgcaggcagcatccagcccggcaagagccgcttcacc
tcgtcgtgccccaccatgaccttcaaggacggcgagctcgacgtggtgctcggcgccccc
ggaggcacgcagatcgcgatgggcgtgctgcaggtgctgctcaacgtgatcgaccacggc
atggaggtgcaggctgccgtgtcggcgccgcgcttctcgtccaccagcaactccatcgac
gtgtgtaaccgcattccgcgttccgtcacgcgcacactggaagcacagggctacgccatt
ggccgcaacccgtacaactacaccatcggctgggtgcacggcgtgcaggtacaggccgat
ggcctgcacggcggcgccgaccccggccgcgatggcgtggcgtaccggctgcgcatggat
cctgcgcgctga

DBGET integrated database retrieval system