KEGG   Variovorax paradoxus EPS: Varpa_0083Help
Entry
Varpa_0083        CDS       T01392                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00900  Terpenoid backbone biosynthesis
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Varpa_0083
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Varpa_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red DUF3248 CMD
Motif
Other DBs
NCBI-ProteinID: ADU34306
UniProt: E6UYX7
Position
complement(83272..84558)
Genome map
AA seq 428 aa AA seqDB search
MVADSRIPNFRALTPAQRFAHIAKAASLTDDEVALLAQPGALSVDRANGMVENVIGTFEL
PLGVAGNFTVNGRDYLVPMAVEEPSVVAAASFMAKLAREGGGFEASSTGPLMRAQVQVIG
ITDPYGARLALLRAREEILAVANSRDKVLIDLGGGCRDIEVHVFGDTPRGAMVVMHLIVD
VRDAMGANTVNTMAEAVSPLVEKLTGGTVRLRILSNLADLRLARARVRLAPAVLATRERS
GEEVVEGVIDAYTFAAIDPYRAATHNKGIMNGVDPVIVATGNDWRAVEAGAHAYACRSGR
YTSLTTWEKDTTGALVGTIEMPMPVGLVGGATKTHPLARLALKILDVKSAQELGEVAVAV
GLAQNLGALRALATEGIQRGHMALHARNIALVAGATGDEIDSIAKQMAAEHDVRTDRAVA
LLEALRKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgactcccgcattcccaatttccgtgccctcacgcccgcgcagcgcttcgcc
cacatcgccaaggccgcatcgctcaccgacgacgaggtggccctgctcgcccagcctggc
gcgctgagcgtggaccgcgccaacggcatggtggagaacgtgatcggcaccttcgagctg
ccgctgggcgtggccggcaacttcaccgtgaacggacgcgactacctcgtgccgatggcg
gtggaagaaccttcggtggtcgccgccgcatcgttcatggccaagctggcgcgcgaaggc
ggcggcttcgaggcctcgagcaccgggccgctgatgcgtgcgcaggtgcaggtgatcggc
atcaccgacccctacggcgcgcggctcgcgctgctgcgtgcgcgcgaagaaatcctggcc
gtggcgaacagccgcgacaaggtgctgatcgatctcggcggcggctgccgcgacatcgag
gtgcatgtgttcggcgacacgccgcgtggcgcgatggtggtgatgcacctgatcgtcgac
gtgcgcgacgcgatgggcgcgaacaccgtcaacaccatggccgaggcggtgtcgccgctg
gtcgagaaactcacgggcggcacggtgcgcctgcgcatcctgtcgaacctggcggacctc
aggctggcgcgtgcgcgcgtgcggctcgcgcctgccgtgctggccacgcgcgagcgcagc
ggcgaagaggtggtcgagggcgtgatcgatgcgtacaccttcgcggccatcgacccctac
cgcgcggcgacgcacaacaagggcatcatgaacggcgtcgatccggtgatcgtcgcgacc
ggcaacgactggcgcgcggtggaagccggcgcacacgcctacgcctgccgtagcgggcgc
tacacgtcgctcaccacgtgggagaaggacacgacgggcgcactcgtcggcaccatcgag
atgccgatgccggtgggcttggtcggcggcgccaccaagacgcacccactcgcgcgcctc
gcattgaagatcctcgatgtgaagtccgcgcaggagttgggcgaagtcgcggtggccgtg
ggcctggcgcaaaacctcggcgccttgcgcgcgctcgccaccgaaggcattcagcgcggc
cacatggcgctgcatgcccgcaacatcgcgctggtcgcgggcgccaccggcgacgagatc
gacagcatcgccaagcagatggccgccgagcacgacgtgcgcaccgatcgcgccgtcgcg
ctgctcgaagcattgcgcaagaagtaa

DBGET integrated database retrieval system