KEGG   Variovorax paradoxus EPS: Varpa_0565
Entry
Varpa_0565        CDS       T01392                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_0565
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_0565
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADU34786
UniProt: E6V5I0
Position
627258..628340
AA seq 360 aa
MEAAVRDPADSVATRVDNALRGWSAEPWSFDYFAVMRRLESVAATTPRWGRALLPSAEPV
RVGQEPSLSFAPASFSRFEPATAYSPPRLRQHFFSYVGPNGPLPVHLSDFIRERSLNHGD
PTWLAFLDSFLHRFSLHFYRAWAQARPAVALDRPGEDRFRLQVGAFVGMGTPGRIGRDEV
HDDARLHFSGWLARRVHNAESVESVLRSYFGVPVTLERWVGHWMRVPSDEVTRLGRGESS
RSMGMGAMLGTRAWDRQHRVRLHMGPLTLDQYRMFLPIGTARPVLQRWMQQLLGDELEWD
AELVLEKAEVPVTRLGQKNGNAPRLGWASWLGQRTRAKDAADVRIGSSSMTVRTAAGAAA
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaggccgctgtgcgggacccggcagattctgtagccacacgcgttgacaacgcgctg
cgcggatggtcggcagagccgtggtcgttcgattacttcgcggtgatgcgccggctcgaa
tcggtggccgcgaccacgccgcgctggggccgcgcgctgctgccgagcgccgagccagta
cgcgtggggcaggagccttcgctctcgttcgcacccgcgagcttcagccgcttcgagccc
gcgaccgcctattcgccgccgcgcctgcgccagcacttcttcagctacgtgggccccaac
ggcccgctgccggttcacctgagcgacttcatccgcgagcgcagcctgaaccatggtgac
ccgacctggctcgcgtttctcgacagctttttgcatcgcttctcgctgcacttctaccgc
gcgtgggcgcaggcgcggcccgcggtggcgctcgaccggccgggcgaagaccgcttcagg
ttgcaggtcggcgcgttcgtcggcatgggcacgccgggccgcatcgggcgcgacgaggtg
cacgacgatgcgcgcctgcatttctcgggctggctcgcgcggcgcgtgcacaacgcggag
agcgtggagtcggtgctgcgcagctacttcggcgtgccggtgacgctggagcgctgggtc
ggccactggatgcgcgtgccatccgacgaggtcacgcggctcgggcggggcgagagttcg
cgctcgatgggcatgggcgcgatgctcggcacccgcgcgtgggaccggcagcaccgcgtg
cgcctgcacatgggcccgctcacgctggaccagtaccgcatgttcctgcccatcggcacc
gcgcggccggtgctgcagcgctggatgcagcaactgctgggcgacgaactcgaatgggac
gccgagctggtgctcgagaaggccgaggtgccggtcacgcgcctcggacagaagaacggc
aacgcgccgcgcctgggctgggcctcgtggctcggccagcgcacgcgtgcgaaggacgca
gcggacgtgcgcatcggcagcagctcgatgactgtccggaccgctgcaggagccgccgca
tga

DBGET integrated database retrieval system