KEGG   Variovorax paradoxus EPS: Varpa_0584
Entry
Varpa_0584        CDS       T01392                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Varpa_0584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_0584
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_0584
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADU34805
UniProt: E6V5J9
Position
complement(652454..652936)
AA seq 160 aa
MAADMFLKLEGVDGESKDDSHKKEIDVLAWSWGASQSGTGHVGGGSGAGKVSVQDVSITK
YVDSSSHLLLLDCCNGQHIKKGTLVVRKAGATPLEYVKLTMEDILVSSIQTGGSGGEDRL
TETLTLNFSKFKYEYTPQKADGSGDGTKETGWDIAANKKV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctgcagacatgtttttgaagctcgaaggcgtcgacggcgaatccaaggacgattcg
cacaagaaggaaatcgacgttctcgcctggagctggggtgccagccagtccggcaccggc
cacgtgggcggcggctcgggcgccggcaaggtgagcgtgcaggacgtttcgatcaccaag
tacgtcgactcttcctcgcacctgctgctcctggattgctgcaatggccagcacatcaag
aagggcacgctggtggtgcgcaaggccggcgccacgccgctcgaatacgtcaagctcacg
atggaagacatcctggtgagcagcatccagaccggcggcagcggcggtgaagaccgcctg
accgagaccctgacgctgaacttctccaagttcaagtacgagtacacgccccagaaggcc
gacggttccggcgacggcaccaaggaaacgggctgggacatcgcagccaacaagaaggtc
tga

DBGET integrated database retrieval system