KEGG   Variovorax paradoxus EPS: Varpa_0586
Entry
Varpa_0586        CDS       T01392                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_0586
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_0586
SSDB
Motif
Pfam: T6SS_VipA Nif11
Other DBs
NCBI-ProteinID: ADU34807
UniProt: E6V6E4
Position
complement(654624..655139)
AA seq 171 aa
MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLSGKPTDPLAPVADRKF
LEIDVDNFDSRMKAMKPRAAFAVENSLTGEGELKVELTFENMEDFSPAAVAKKVGALNKL
LEARTQLSNLVTYMDGKNGAEELLAKVLEDPALLQSLAATAKPEDGSKPAA
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccaagagcagtcagaaattcatcgcccgcaaccgggcgccacgcgtgcagatcgaa
tacgacgtcgaactctacggcgccgagaagaagatccagctgcccttcgtgatgggggtg
ctggccgacctgtcgggcaagcccaccgatccgctcgcgcccgtggccgatcgcaagttc
ctcgagatcgacgtcgacaacttcgactcgcgcatgaaggccatgaagccgcgcgccgcg
ttcgcggtggagaactcgctcaccggcgaaggcgaactcaaggtcgaactgaccttcgag
aacatggaagatttttcccccgcggccgtcgccaagaaggtcggtgcgctcaacaagctg
ctcgaagcacgcacgcagctgtccaacctggtgacctacatggacggcaagaacggcgcc
gaggaactgctggccaaggtgctggaagacccggccctcctgcagtcgctggcggctacc
gccaagcccgaggacggcagcaagccggccgcctga

DBGET integrated database retrieval system