KEGG   Variovorax paradoxus EPS: Varpa_0589
Entry
Varpa_0589        CDS       T01392                                 

Definition
(GenBank) hypothetical protein
Organism
vpe  Variovorax paradoxus EPS
SSDB
Motif
Pfam: IcmF-related_N
Other DBs
NCBI-ProteinID: ADU34810
UniProt: E6V6E7
Position
complement(656848..657987)
AA seq 379 aa
MTALLSSPTHFFWMLLALCLLGFGLLCAMVHDAGRGARRRALLRRIETLDAPTDEAAVGA
LRESMAEARQALRQQAPRPARSSHDPAAPVPWFLFIGDAAADLPGLLATAQGKRLARPDS
APDDGACWRWWLTGALTAIEVQPAAVGEAAGAPRTRALWLQALLALAERRDRLPLNGVVA
CFSASELLQADADSLRPLAAKMRRLIDEAGDTLRLQLPMYLVITGLEHLTGYAALRGALP
PEVLAQALGHRLPDPFAAPSATAGDRLDTLFDPIAAQLQSLRMALMREQHGAAARLSIHG
FVEAVQGLQPALREVAEVLFESHGKGSRAPRWRGLYFTAAASDATGGAFVTDLFERFLPA
DQPLVRPGRPSSNTAAGAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaccgcgctgctctcctcgcccacgcacttcttctggatgctgctcgcgctgtgcctg
ctgggcttcgggctgctgtgcgcgatggtgcacgacgcgggccgcggtgcgcggcggcgt
gccttgctgcgccgcatcgagacgctcgatgcgcccacggacgaggcggccgtcggggcg
ctgcgggaatcgatggcagaggcgcgtcaggcgctgcggcagcaggcgccgcggcccgca
cggtcgtcgcacgacccggctgcgccggtgccgtggttcctgttcatcggcgatgcggcg
gccgacctgccggggctgctggccaccgcgcagggcaagcgcctcgcgcggcccgacagc
gcccccgacgatggggcctgctggcgctggtggctgaccggtgcgctgaccgccatcgag
gtgcagcccgcggcggtcggcgaagccgccggcgcaccgcgcacgcgcgccctgtggctg
caggcgctgctggcgctggccgagcggcgcgaccgcctgccgctcaacggcgtggtcgcg
tgcttctccgcgagcgagctgctgcaggccgacgccgacagcctgcgcccccttgccgcg
aagatgcgccggctgatcgacgaggcgggcgacaccctgcgcctgcagttgcccatgtac
ctcgtcatcaccggcctggagcatctgacgggctacgccgccctgcgcggcgcgctgccg
cccgaggtgctggcgcaggcgctgggccatcgcctgccggacccgtttgccgcgcccagc
gcaaccgccggcgatcggctcgatacgctgttcgaccccatcgccgcgcaactgcagagc
cttcgcatggcgttgatgcgcgagcagcacggggccgcggcgcggctctcgatccatggg
ttcgtggaagcggtgcagggattgcagcccgcattgcgcgaggtggcggaggtcttgttc
gagagccacggcaagggctcgcgcgcgccgcgctggcgcggcctctacttcactgccgcc
gcatcggatgcaactggcggggccttcgtgaccgatctgttcgagcgcttcctgccggcc
gatcagcccctggtgcgaccagggcgtccgtcgtccaacacagcggcaggtgcgccatga

DBGET integrated database retrieval system