KEGG   Variovorax paradoxus EPS: Varpa_1418Help
Entry
Varpa_1418        CDS       T01392                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00240  Pyrimidine metabolism
vpe00250  Alanine, aspartate and glutamate metabolism
vpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Varpa_1418
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Varpa_1418
Enzymes [BR:vpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Varpa_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADU35634
UniProt: E6V1H8
Position
1578712..1580010
Genome map
AA seq 432 aa AA seqDB search
MAYISSMSQQQDILRDAMRRLNLTRDAFSERLGVRRRALDTWLLPADSGESRAMPEMVGK
FVAEILQREAQATTGADDRPLAQRIAAEGRPHLLSVAQFDRDSLEALFQVADVMQPIARR
QKVTRVLEGAVLGSLFFEASTRTRVSFGAAFCRLGGTVCDTTGFTFSSMAKGESIYDTSR
VMSGYVDALVVRHPEQGSVAEFARATNIPVINAGDGPGEHPSQAILDLYTIQREFSRMGK
LVDGTHVAMVGDLKYGRTVHSLIRLLSLYRGLKFTLIAPPSLEMPAYLLDLVARNGHVIE
QTQSLEEGLRGADVVYATRIQKERFAGEEIEGYTPEFQIRKALVDTLCKPDTILMHPLPR
DGRPGANDLSIDLNHDPRLAIFRQTDNGIPVRMALFAVLMGVEHQVARSMRDAGWRSPAH
IGPDDADFDGLD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacatttcatccatgagccagcaacaagacatcctgcgcgacgccatgcgccgc
ctcaatctcacccgcgatgcgttctccgagcgcctgggtgtccgccgccgggcgctcgac
acctggttgctgcccgccgactccggcgagtcgcgggccatgcccgaaatggtggggaag
ttcgtcgccgaaatcctgcagcgcgaggcgcaggcaaccaccggcgcggacgatcggccc
ctggcgcagcgcattgcggcggaggggcggccgcacctgttgtcggtcgcgcagttcgac
cgcgacagcctcgaggccctgttccaggtggccgatgtcatgcagccgatcgcgcggcgc
cagaaggtcacgcgcgtgctcgaaggcgcggtgctcggcagcctgttcttcgaggccagc
acccgcacccgcgtgagcttcggcgcggcgttctgccggctcggcggcacggtctgcgac
accacgggattcaccttctcctcgatggccaagggcgaatcgatctacgacaccagccgt
gtgatgagcggctacgtcgatgcgctggtggtgcgccatcccgagcagggctcggtggcc
gaattcgcgcgggccaccaacatcccggtcatcaatgccggcgacgggccgggcgagcat
ccgagccaggccatccttgacctgtacacgatccagcgcgagttctcgcgcatgggcaag
ctggtcgacggcacgcacgtggcgatggtcggcgacctgaagtacggccgcacggtgcat
tcgctgatccgcctgctgtcgctctaccggggcctgaaattcacgctcatcgcgccgccg
tcgctcgagatgccggcctacctgctggacctggtggcgcgcaatggccacgtgatcgag
cagacccagtcgctcgaggagggcctgcgcggcgccgacgtggtgtacgccacccgcatc
cagaaggagcgcttcgcgggcgaggagatcgagggctacacgcccgagttccagatccga
aaggcgctggtggacacgctctgcaagcccgacaccatcctcatgcatccgctgccgcgc
gacgggcgcccgggcgcgaacgacctgagcatcgacctcaaccacgatccgcggctggcg
atcttccggcagaccgacaacggcatcccggtgcgcatggcgctgttcgcggtgctgatg
ggcgtcgagcaccaggtggcgcgttcgatgcgcgatgcgggctggcgctcgcccgcgcac
atcggccccgacgatgcggacttcgatgggctggactga

DBGET integrated database retrieval system