KEGG   Variovorax paradoxus EPS: Varpa_1559Help
Entry
Varpa_1559        CDS       T01392                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00260  Glycine, serine and threonine metabolism
vpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
vpe01230  Biosynthesis of amino acids
Module
vpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_1559
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Varpa_1559
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Varpa_1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PEP_mutase PcrB
Motif
Other DBs
NCBI-ProteinID: ADU35770
UniProt: E6V3J0
Position
complement(1730101..1730946)
Genome map
AA seq 281 aa AA seqDB search
MSRIAATFKTLEAQGRKALIPYVTAGFPFADITPELMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEAALALGVGMKQVLAIVAAFRQKDTTTPVVLMGYANPVERYDLVHGKQAFIR
DASAAGVDGLLVVDYPPEECEAFAADLKAANIDLIFLLAPTSTDERMAQVARIASGYVYY
VSLKGVTGAGHLDTEAVGQMIPRIRQHVSIPVGVGFGIRDARTAQAVGSAADAVVIGTKI
IQLIDGQPREKVVPAVREFLAGIREALDALPAATPKNAAGR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgccgccaccttcaagaccctcgaggcgcagggccgcaaggcgctgatt
ccgtatgtcaccgccggcttccccttcgccgacatcacccccgagctaatgcacggcatg
gtcgaggcaggcgccgacgtgatcgagctgggcgtgcctttttccgacccgatggccgac
ggccctgtgatccagaaggccggcgaagccgcgctggccctgggcgtcggcatgaagcag
gtgctcgccatcgtggccgcgtttcgccagaaggacacgaccacgccggtggtgttgatg
ggctatgcgaacccggtcgagcgctatgacctcgtgcacggcaaacaggccttcatccgc
gacgcatcggccgccggggtcgacggcctgctggtcgtcgactacccgcccgaggaatgc
gaggccttcgctgccgacctgaaggcggcgaacatcgacctgatcttcctgctggcgccc
acgagcaccgacgagcgcatggcgcaggtcgcgcgcatcgcgagcggctacgtctactac
gtgtcgctcaagggcgtgaccggcgccggccacctggacaccgaggcggtcggccagatg
atcccgcgcatccgtcagcatgtgagcatcccggtcggcgtgggcttcggcatccgcgac
gcacgcaccgcgcaggcggtcggttcggcggcggacgccgtggtgatcggcaccaagatc
atccagctgatcgacgggcaaccgcgcgagaaggtggtgcccgcggtgcgcgaattcctc
gccggcatccgcgaggcgctggacgccctgccggcggctacccccaagaatgcggctggc
cgataa

DBGET integrated database retrieval system