KEGG   Variovorax paradoxus EPS: Varpa_2899
Entry
Varpa_2899        CDS       T01392                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_2899
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_2899
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADU37090
UniProt: E6V5U9
Position
3119135..3119707
AA seq 190 aa
MADNRVRNSGQKFIARNRAPRVQIEYDVEIYGSERKIQLPFVMGVIADLAGKQMDPMPDL
AERDFMEVDIDNFDDRMKAIKPRVAFQVPNTLTGEGQMNVDITFDTMDDFSPARIAGQVG
ALQQLLAARTELSNLLSYMDGKNGAEQLIAQALQNPALLKSLASAPNPAVAKAVEAANEK
AGHAPGGSPE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcagacaaccgtgtcagaaacagtggtcagaagttcatcgcgcggaaccgggcgccg
cgtgtgcagatcgagtacgacgtcgagatctacggcagcgaacgcaagatccagctgccc
ttcgtgatgggcgtgatcgccgacctcgcgggcaagcagatggacccgatgcccgatctg
gccgagcgcgatttcatggaagtcgacatcgacaacttcgacgaccgcatgaaggcgatc
aagccgcgcgtggcgttccaggtgcccaacacgctcacgggcgaaggccagatgaatgtc
gacatcaccttcgacaccatggacgacttctcgcccgcgcgcatcgcgggccaggtgggc
gcgttgcagcagttgctcgccgcacgcaccgaactgtcgaacctgctctcgtacatggac
ggcaagaacggtgccgagcaattgatcgcgcaggccctgcagaacccggcgctgctcaag
tcgctcgcttccgcgcccaacccggctgtcgccaaggcggtcgaagcggcgaacgagaaa
gcgggccacgcgcccggcggttctcccgagtaa

DBGET integrated database retrieval system