KEGG   Variovorax paradoxus EPS: Varpa_2908
Entry
Varpa_2908        CDS       T01392                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Varpa_2908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_2908
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_2908
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Orthopox_C10L
Other DBs
NCBI-ProteinID: ADU37099
UniProt: E6V5V8
Position
3131556..3133886
AA seq 776 aa
MTRIVKAHTPLGEEQLKFRSMRGTEGLSQLFELEVDLLSPSAALDLKSVLGKPLSLEIRT
AGARPRFLNGQVVRFSMVGREGGTSRHTVYRASVRPWLWYLMRSSDNKIFQNKSVVEILE
EVLGDYGFAFEKKLGGSYRTWEYCVQYNESDFAFVSRLMELEGIYYWFRHEKGQHTLVLA
DDAGAHEPMPDYETIDYFAADRDIGEDLEVIRDWQPGEEVRSGSYTVDDFNFTTPKGDLV
NVRSQPRAHDNAGYEMYEWLGDYPAAGDGEHYARVRLEESQALAQRSAGSSTVRGMAPGY
TFRMRNSPRSDDNQEYLVVAVSYALREGGYASGAARGEYNFDFMVQPSALAFRAPRQTPV
PRTSGPQTATVVGPEGEEIWTDEYGRVKVQFHWDRYGQKNENSSRFVRVSHIWAGERFGG
VFTPRIGQEVVVDFIGGRVDRPVIVGRVYNADQMPPFALPGEATKSGIVTRSSKGGSGAN
ANAFVFEDKMGAEQILLHAERNLDVEVEGDETHTTDKTRSTLIKGHESATYESGEERHIT
AGAVETIDGGEERTVTGGATETVTGGEERTITGGATETITGGETRTVTGGLTETVNGGVT
LTVNGNSIRLLSGSDLRITCSGRIETVNAMDIKQVNGTDCTMVTGPKIVVAPLITYHTTQ
HIDTTSTYTIDATVSITRSPHTILNVSDETWLKCNFLRWSNQTVRALVLATDFYGMKLQA
CAINTQINGWFTNRATTFLLDAPIKFETSARSSKKKGLNIGVCKLHLSCVYMTKKK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgaccaggatcgtgaaggcgcatacgccactgggtgaagagcagctgaagttccgttcg
atgcgcggcacggaagggctgtcgcagctgttcgagctggaggtggacctgctgagtccg
agcgcggcgctggacctgaagtcggtgctgggcaagccgctgtcgctggagatccgcacg
gcgggtgcgcggccgcggttcctgaacgggcaggtggtgcgcttctcgatggtggggcgc
gagggcggcacgtcgcgccacacggtgtaccgcgcgagcgttcggccgtggctgtggtac
ctcatgcgctcgagcgacaacaagatcttccagaacaagagcgtggtggagatcctggag
gaggtgctgggcgactacggcttcgcgttcgagaagaagctgggcggcagctaccgcacg
tgggagtactgcgtgcagtacaacgagagcgacttcgcgttcgtgagccggctgatggag
ctggaaggcatctactactggttcaggcatgagaagggccagcacacgctggtgctggcc
gacgatgcgggtgcgcacgagccgatgccggactacgagaccatcgactacttcgcggcc
gaccgtgacatcggcgaggacctggaggtcatccgcgactggcagcccggcgaggaggtg
cgctcgggcagctacacggtggacgacttcaacttcaccacgcccaagggcgacctggtg
aacgttcgcagccaaccgcgcgcgcacgacaacgccggctacgagatgtacgagtggctg
ggggactacccggccgcgggcgacggcgagcactatgcgcgggtgcggctggaagagtcg
caggcgctggcgcaacgcagcgccggatcttcgacggtgcgcggcatggcgccggggtac
acgttcaggatgcgcaactcgccgcgctcggacgacaaccaagagtacctggtggtggcg
gtgtcgtatgcgctgcgcgaaggcggttatgcgagcggggcggccaggggcgaatacaac
ttcgacttcatggtgcagcccagcgcgctggcgttcagggcgccgcggcaaacgccggtg
ccgcgcacgagcgggccgcagacggcgacggtggtggggcccgagggcgaggagatctgg
accgacgagtacggacgtgtgaaggtgcagttccactgggaccgctacggccagaagaac
gagaacagctcgcgcttcgtgcgggtgtcgcacatctgggccggggagcgcttcgggggc
gtgttcacgccgcgcatcggccaggaggtggtggtggacttcatcggcgggcgagtcgac
cggccggtgatcgtggggcgggtgtacaacgcggaccagatgccgccgttcgcgttgccg
ggcgaggcgaccaagagcggcatcgtgacgcgctcgagcaagggcggctcgggcgcgaac
gcgaacgccttcgtgttcgaggacaagatgggcgccgagcagatcctgctgcacgccgag
cgcaacctggacgtggaggtggaaggcgacgagacgcacacgaccgacaagacgcgcagc
acgctgatcaaggggcacgagtcggcgacctacgagtcgggggaagagcggcacatcacc
gccggggcggtggagacgatcgacgggggcgaggagcgcacggtgacgggcggcgcgacc
gagacggtgacgggcggcgaggaacgcacgatcacgggcggagcgaccgagaccatcacc
ggcggggagacgcgcacggtcaccggcggcctgaccgagacggtcaatggcggcgtgaca
ctgacggtcaacggcaacagcatccggctgctgagcggctcggatctgcgcatcacctgc
agcgggcgcatcgagacggtcaatgcgatggacatcaagcaggtgaacgggaccgactgc
accatggtcaccggcccgaagatcgtggtcgcgccgctgatcacctatcacacgacgcag
cacatcgacaccacgagcacctacacgatcgacgcgacggtgagcatcaccagatcgccc
cacacgatcctcaacgtgtccgacgagacgtggctcaagtgcaatttcctgcggtggtcc
aaccagaccgtgcgggcgctcgttctcgcgaccgatttctatgggatgaagctgcaggcc
tgcgcgatcaacacgcagatcaacggctggttcaccaacagggcgacgaccttcctgctc
gacgcgccgatcaagttcgagacctcggcgcgcagttcgaagaagaagggactgaacatc
ggcgtttgcaagctgcacctgtcgtgcgtctacatgacgaagaagaaatga

DBGET integrated database retrieval system