KEGG   Variovorax paradoxus EPS: Varpa_3270Help
Entry
Varpa_3270        CDS       T01392                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Varpa_3270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_3270
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ADU37455
UniProt: E6VB06
Position
complement(3519276..3523274)
Genome map
AA seq 1332 aa AA seqDB search
MQYLKQFLAFLFSRQMLAFVAMVLLALAIWFVGPLLAVDGLRPLASVGVRVAFIVLLLVL
GILWLVSGPYSLVGVAALCLLLWHAGPLLDIGAVKPLASVGVRVAIIGAILLLYALSWLY
RFWQALRNNEDLLAKVLSFGKDAGKDETAKEEIKTVTAAVHRALAQLKGLRGRGGLRRLF
EGNRYLYELPWYMVIGSAGAGKTTALLNAGLQFPLARQMGNASKRVVFKSEGGTLHCDWW
FANEAVFIDTAGRYTTQERNPATDPVEWRAFLGLLRKHRTRAPLNGVIVALDAGEMLTMT
EMERAEHASLVHDRLTDLRQELGIRFPVYVVVTKMDLLRGFSEYFQSLTSEGRMQAWGFA
LPFHGIKNTRAGTQARDSLRTQMDKELALLNDRLAEGLRARLNEEFDVERRKRLFALPKE
LAALAVPLVPMLDQIFLVSRFDRTQLHDTLRGVYFTSGAQAHAEVPADHQTLVQRLQSSL
GPSSSSGLQAAGTSPEQGQQGFFLQELLTKVIIPEAHLVRPNLRWEFRFRLLRLMGHALA
LVIFIWLAGALAVSFGNNRRYLDTVSQRTDVLAGQVSALFGSFKPSGVPDVLNGARELPG
YAGLDIDSPPGSFRYGLYSVPPVLAVTADTYAQLQDHTLLPTILQRMEAVLTQSMKDGDA
KAAYETLRVYKLLHDKDRYMKGGARDVSNWVLKDWEHADSAAAFGGRASMAGHATALFSG
ERPVQSASLPNEALVRAVQDFLNSNTSTQRVYERAKAAMLREAPQEFTLVRAVGPQAGTV
FSRAGGLPLEKGVPGLFTYDGYHDVFSKRLPEFVGQAIDDDAWVMGRNASAVLDAAARKL
QNDPFLDDIRRQYLSEYAQHWESFLESIRTVGGSDTTGTSLGFDLSVLRQFAAPDSPLAR
LARAAARETTLSRPLVVRAQEEKGFLDKASDELNKQTSAIGRNLGIRAEERLEKEIVDNR
FAALREVVTGQPDIGAASAGATGAKPGLETISGLVNEFYTLLVVADTALTAGSLPPGGSE
VGSRLKLEAGKLPAPFREVLTALATSGGDKVALGSTGILRNQAQQQLDRIMGLMAMQVSE
PCKRGVEGRYPLAAVAQDASIEDFTLVFAASGAADEFFNKYLASYVDTSVRPWRYKDPNV
AQAVAGAEGVAGGVAPAPATPGPTLLGELLKLLAQSGPNLDAFYRAQQIRDLFFRDAGGK
KLAWKMDLRVLELEPSITDLIIDIDGQGQRYIHGPVQAFTVHWPGPRGGAMAEITANPRI
SGPTSTLLASGPWALFRLLEKGRIVNTATPGRLSVEYSFDGRKALIDINSGSQPNPLNSD
VLKGFRCPGRAA
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacctcaaacagttcctggcatttcttttttcccggcagatgctggctttcgtc
gccatggtgctgctggcgctggcgatctggttcgtcggtcccttgcttgccgtggatgga
ctgcgtccgctggcttcggtcggcgtgcgcgtggccttcatcgtgctgctgctggtgctt
ggcatcctctggctcgtttcggggccgtacagcctggtcggggtggcagcgctgtgcctg
ttgctctggcacgcggggcccttgctagatattggtgctgtaaagccgctcgcatcggtc
ggggtgcgcgtggcgatcattggcgcgatcctgctgctgtacgcgttgtcctggctctat
cgcttctggcaggccttgcgcaacaacgaggacctgctcgcgaaggtcctgagcttcggg
aaggacgcgggcaaggacgagacggccaaggaagagatcaagacggtcaccgccgccgtc
catcgcgccttggcgcaactcaagggcctgcgcgggcgcggtggattgcgtcgcctgttc
gaaggcaatcgctatctgtacgaactgccctggtacatggtcatcggcagcgccggcgcg
gggaaaaccacggcgctgctcaacgccgggctgcagtttcccctggcgcgccagatgggc
aatgcgtcgaagcgcgtggtgttcaagtctgaagggggcacgctgcattgcgactggtgg
tttgccaacgaggccgtgttcatcgacacagcaggccgctacaccacgcaggagcgcaat
cctgcaaccgatccggtcgagtggcgcgctttcctcggcctgcttcgcaagcaccgcacg
cgtgcgccgctcaatggcgtgatcgtcgcgctcgatgcaggcgagatgctgaccatgacc
gagatggagcgtgccgagcatgcgagcctggtgcacgaccgcctgaccgatctgcgccag
gaattgggcatccgctttcccgtgtatgtggtcgtcacgaagatggatctgttgcgggga
ttcagcgaatactttcaatcgctcaccagcgaagggcgcatgcaggcctggggcttcgcg
ctgccattccacggcataaagaacacgcgggccggaacgcaggcccgagacagcctgcgc
acgcagatggataaggagctcgcattgctcaacgaccggttggccgaggggctccgtgcg
aggctgaatgaggagttcgacgtcgagcgccgcaagcgcttgtttgcactgcccaaggaa
ctggccgccttggctgtgccgctggtgccgatgctggaccagatctttctcgtctcgcgc
ttcgacaggacccagttgcacgacacgctgcgcggcgtgtacttcacgagcggtgcgcaa
gctcatgcggaggtgcccgccgaccaccagacgctggtccagcgactgcagagcagcctc
ggcccgtcgtcatcttcgggtctgcaagccgcgggcacgtcgcccgaacaggggcagcaa
ggattctttctccaggagttgctgaccaaggtcatcatcccggaagcccatctggtgagg
cccaatctgcgctgggaatttcggttccggctgctgcgcctgatggggcacgccctggcg
ctcgtgatcttcatctggctggccggtgcgctggccgtgagcttcggcaataaccgtcga
tacctggacactgtcagccagcgtaccgatgtactcgcgggtcaagtgagcgcgctgttc
ggcagcttcaagccatctggcgtaccggatgtgctgaacggcgcgcgcgagttgcccggc
tatgcggggctggacatcgacagcccgccgggcagctttcgctatggcctgtacagcgtg
ccgccagtgctggctgtgactgccgacacctacgcccagctgcaggaccacaccttgctc
ccgaccatcctgcagcgcatggaggccgtgctgacgcagagcatgaaggacggcgatgcg
aaggccgcctatgaaaccctgcgcgtctacaagctcctgcacgacaaggaccggtacatg
aaaggaggcgctcgggacgtcagcaactgggttctcaaggactgggagcatgccgacagt
gccgccgcctttggcgggcgcgcttcgatggcaggccatgccacggcactcttttccggc
gagcgtccggtgcagtcggcatcgctgcccaacgaggcgctcgtgcgtgcggtgcaggac
ttcctgaacagcaacacctcgacgcaacgcgtctacgaacgcgccaaggcggcgatgctg
cgcgaagccccccaggagttcacattggtccgggcggtcgggccgcaagccggcaccgtg
ttctcccgtgccggcggcctgcctctcgagaaaggcgtgccgggccttttcacctacgac
ggataccacgacgtcttcagcaagcggttgccggaattcgtcgggcaggccattgacgac
gacgcatgggtgatggggcgcaatgcttcagcggtgctcgatgctgctgcccgaaaattg
cagaacgatccgttcctcgacgacatccgtcgccagtacctgagcgaatatgcccagcac
tgggaatcctttctcgaatcgattcgcacggtcgggggcagcgacaccaccggcaccagc
ctggggttcgacctgagcgtgttgcggcagttcgccgcgcccgactcgccgctggcgcgg
ctggcgcgcgcggcggcacgcgagaccacgctgtcgcgtccgctggtcgtgcgtgcccag
gaggaaaaggggttcctcgacaaggcttccgatgaactgaacaagcagaccagcgcgatc
ggcaggaacctcggcattcgcgcggaggaacgactcgaaaaggaaatcgtcgacaaccgc
tttgccgcgttgcgcgaagtggtgacgggccagccggatatcggtgctgcaagcgctgga
gccaccggcgccaagccggggctcgaaacaatctcgggcctcgtcaacgagttctacacg
ctgcttgtcgtggccgatacggcgctgactgcaggaagccttccacccggaggctccgaa
gtcggttcgcggctgaagctggaggccggaaagctcccggcgccgtttcgcgaggtgctg
accgcattggccacgagcggcggcgacaaggtggcgctcggttccacaggcatcctgcgc
aaccaggcccagcagcagctcgatcgcatcatgggcctgatggcgatgcaggtcagtgaa
ccgtgcaagcgtggcgtggaagggcgctatccgctggccgcggtggcgcaggacgcatcg
atagaagacttcacgctggtcttcgccgcgagcggcgccgcggacgagttcttcaataag
tacctggcttcctacgtcgataccagcgtgcgtccatggcgctacaaggatccgaatgtg
gcccaggccgttgccggtgccgagggtgttgccggcggagtggcaccggctcccgcgacc
ccagggccgacattgcttggcgaactgctcaagctgttggcgcaaagcgggccgaacctc
gatgccttctatcgcgcccagcagatccgcgaccttttcttccgcgatgcgggcggcaag
aaactcgcttggaagatggacctgcgggtgctcgaactggagcccagcatcaccgatctg
atcatcgacatcgacgggcagggccagcgctacatccatggcccggtgcaggcgtttacc
gttcattggcctgggccgcgtggcggtgcaatggcggagatcacggccaatccgcgcatc
tcgggacctacctcgacccttctggccagtggtccatgggcgttgttccgattgcttgaa
aagggtcgcatcgtgaacacggcgacgccggggcggctgagcgtcgaatattcgttcgac
ggtcgcaaggcgttgatcgacatcaactcgggcagccagcccaacccgctcaacagcgat
gtgctcaagggcttccgctgcccgggtcgagcggcatga

DBGET integrated database retrieval system