KEGG   Variovorax paradoxus EPS: Varpa_3273
Entry
Varpa_3273        CDS       T01392                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Varpa_3273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_3273
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_3273
SSDB
Motif
Pfam: T6SS-SciN EAV_GP5
Other DBs
NCBI-ProteinID: ADU37458
UniProt: E6VB09
Position
complement(3526056..3526613)
AA seq 185 aa
MSFNVPCPRRTASRQWLFVVLSLLVLALALATAQPSHAQFSYPREQTKLDITITAEAGVN
PDDKGRAAPILVRIYELKSEGVFEAADYFSLSSNDKALIGSELLVRDEFILRPGDVKTIR
RKSHPDLAAIGVVAGYRDLAQADWRAVQKIDPAPEVAWYRSVLPANKLKLQIDLQAKGIQ
LTPLK
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcattcaatgtgccttgtccccggcgaaccgcctcacggcaatggcttttcgtggtg
ctctcgttgctcgttctggcgctcgcactggccacggcgcagccctcgcatgcccagttc
tcctacccgcgagagcagacaaagctcgatatcacgatcacggcggaggccggcgtcaat
cccgacgacaagggccgggcggcgcccatcctggtgcgcatctacgaactcaagtcggaa
ggcgtcttcgaagccgccgactacttttcgctctccagcaatgacaaggccctgatcggc
agcgagctgctcgttcgagacgaattcatcctgcggcccggcgatgtcaagaccatccgc
cgcaaatcgcaccccgaccttgcggccatcggtgtcgtcgccggctaccgcgatctcgcg
caagccgattggcgagcggtgcaaaagatcgatcccgcaccggaagtcgcctggtatcgc
tcggtcctgccggcgaacaagctcaagttgcagatcgaccttcaagccaagggcatccag
ctcacccccctcaaatag

DBGET integrated database retrieval system